2024-03-20 REL RCSB RCSB RCSB 2018-11-13 2018-12-12 2019-07-03 2024-03-20 Helical assembly of the CARD9 CARD Holliday MJ Rohou A CARD, filament, helical assembly, death domain, innate immunity, SIGNALING PROTEIN Holliday MJ Witt A Rodriguez Gama A Walters BT Arthur CP Halfmann R Rohou A Dueber EC Fairbrother WJ Structures of autoinhibited and polymerized forms of CARD9 reveal mechanisms of CARD9 and CARD11 activation. Nat Commun UK 10 3070 3070 2019 31296852 doi:10.1038/s41467-019-10953-z 2041-1723 6n2p FULLOVERLAP Helical assembly of the CARD9 CARD. Helical assembly of the CARD9 CARD. 0 1
Formed from CARD9 2-152 dimer with an I107E mutation, purified with 1:1 Zn. 1 mM EDTA was added to 0.5 mM protein, followed by 10 minute incubation at 25C.
Homo sapiens 34.0 Caspase recruitment domain-containing protein 9 Homo sapiens 0.017351873 10 Escherichia coli BL21(DE3) LEVO GSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFL ESLELYYPQLYKKVTGKEPARVFSMIEDASGESGLTQLLMTEVMKLQKKVQDLTALLSSKDDFIKELRVKDS Q9H257 helical filament 8.67 7.0 50.0 C8H18N2O4S HEPES 150.0 NaCl Sodium Chloride 0.5 C9H15O6P TCEP 0.5 Zn Zinc 1.0 C10H16N2O8 EDTA C-flat-2/1 COPPER 200 GLOW DISCHARGE ETHANE 100 277 FEI VITROBOT MARK IV
Sample was incubated on the grid for 1 minute, subsequently washed/blotted 6 times in buffer, followed by addition of 3.5 ul buffer, which was blotted by vitrobot for 5 seconds prior to plunging..
Formed from CARD9 2-152 dimer with an I107E mutation, purified with 1:1 Zn. 1 mM EDTA was added to 0.5 mM protein, followed by 10 minute incubation at 25C. Sample was subsequently diluted 1:5 before adding to grid.
 FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 100.0 2.7 1.25 2.5 130000.0 NITROGEN 20 GATAN K2 SUMMIT (4k x 4k) COUNTING 3838 3710 1-40 1 4403 10.0 50.9
Collected in movie-mode at 4 frames per second
 1 5.11 -101.6 C1 4.0 FSC 0.143 CUT-OFF FREALIGN 9.11
A 5.0 A high-resolution limit was used for particle alignment in frealign.
31908 141592 EMAN2 Filaments were manually selected using e2helixboxer.py. RELION 2.1 Segments were extracted from filaments using RELION.
Filaments were manually selected using e2helixboxer.py. Segments were extracted from filaments using RELION, using a 30 A shift between particles.
Ab initio 3D reconstruction was generated in C1 in cisTEM and used as a startup model.
 NOT APPLICABLE FREALIGN 9.11
Final assignment was performed in helical frealign using helical parameters of 5.11-A rise and 101.6 degree rotation.
 emd_9332.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 300 300 300 0 0 0 300 300 300 325.5 325.5 325.5 90.0 90.0 90.0 X Y Z -0.013754008 0.0614793 -0.00050711195 0.004071336 1.085 1.085 1.085 0.033 AUTHOR Helical assembly of the CARD9 CARD 6E26 A 8-95 PDB experimental model RIGID BODY FIT
"Fit in map" in UCSF Chimera was used to fit the previously determined, lowest energy NMR solution structure (PDB ID 6E26) into the sharpened density and to generate 9 symmetry-mates according to the determined helical parameters. The map was then iteratively refined in Phenix and Coot, maintaining strict non-crystallographic symmetry among the CARDs.
REAL emd_9332_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 300 300 300 0 0 0 300 300 300 325.5 325.5 325.5 90.0 90.0 90.0 X Y Z -0.18431102 0.26723814 -0.00034067212 0.013061095 1.085 1.085 1.085 AUTHOR CARD9 CARD helical filament, sharpened.