2024-03-13 REL RCSB RCSB RCSB 2018-10-18 2018-08-01 2019-03-13 2024-03-13 German Research Foundation (DFG) DFG FA 456/15-1 Germany German Research Foundation (DFG) DFG SCHM 3276/1 Germany Cryo-EM structure of human AA amyloid fibril Rennegarbe M Liberta F Fandrich M Schmidt M AA-amyloidosis, Serum Amyloid A, cross-beta, helical, protein fibril Liberta F Loerch S Rennegarbe M Schierhorn A Westermark P Westermark GT Hazenberg BPC Grigorieff N Fandrich M Schmidt M Cryo-EM fibril structures from systemic AA amyloidosis reveal the species complementarity of pathological amyloids. Nat Commun UK 10 1104 1104 2019 30846696 doi:10.1038/s41467-019-09033-z 2041-1723 6mst FULLOVERLAP human AA amyloid fibril human AA amyloid fibril 0 1 Homo sapiens kidney Serum amyloid A-1 protein Homo sapiens 0.007481154 12 LEVO SFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQR P0DJI8 helical helicalArray 0.2 7.0 ddH2O C-flat-1.2/1.3 4C COPPER GLOW DISCHARGE OTHER 0.025
15 mA
 ETHANE 95 293 FEI VITROBOT MARK III FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 50.0 2.7 -0.5 -2.5 130000.0 NITROGEN GATAN K2 SUMMIT (4k x 4k) COUNTING 12.0 40.0 1 2.4 0.79 C1 2.7 FSC 0.143 CUT-OFF RELION 2.1 91872 93025 RELION 2.1 NOT APPLICABLE RELION 2.1 emd_9232.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 270 270 270 0 0 0 270 270 270 280.8 280.8 280.8 90.0 90.0 90.0 X Y Z -0.23911723 0.5025357 0.00038090933 0.009526984 1.04 1.04 1.04 0.05 AUTHOR Cryo-EM reconstruction of human Serum Amyloid A fibrils, extracted from diseased human kidney. The fibril shows a helical rise of 2.40 A, a helical twist of 180.79 degree and a resolution of 2.7 A. AB INITIO MODEL emd_9232_msk_1.map emd_9232_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 270 270 270 0 0 0 270 270 270 280.8 280.8 280.8 90.0 90.0 90.0 X Y Z -0.020660006 0.07421452 0.0016040447 0.005379957 1.04 1.04 1.04 AUTHOR One of the two independently refined half maps. emd_9232_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 270 270 270 0 0 0 270 270 270 280.8 280.8 280.8 90.0 90.0 90.0 X Y Z -0.019018821 0.07553954 0.0016195278 0.005337766 1.04 1.04 1.04 AUTHOR One of the two independently refined half maps.