2018-12-05 REL RCSB RCSB RCSB 2018-06-12 2018-06-27 2018-10-10 2018-12-05 Cryo-EM Structures of ASC and NLRC4 CARD Filaments Reveal a Unified Mechanism of Nucleation and Activation of Caspase-1 Li Y Fu T Wu H Li Y Fu TM Lu A Witt K Ruan J Shen C Wu H Cryo-EM structures of ASC and NLRC4 CARD filaments reveal a unified mechanism of nucleation and activation of caspase-1. Proc. Natl. Acad. Sci. U.S.A. US 115 10845 10852 2018 30279182 doi:10.1073/pnas.1810524115 1091-6490 0040 PNASA6 EMD-8902 associated EM volume
Cryo-EM Structures of ASC and NLRC4 CARD Filaments Reveal a Unified Mechanism of Nucleation and Activation of Caspase-1
 6n1h FULLOVERLAP Caspase recruitment domain of Apoptosis-associated speck-like protein containing a CARD Caspase recruitment domain of Apoptosis-associated speck-like protein containing a CARD 0 1 Homo sapiens Escherichia coli-Pichia pastoris shuttle vector pPpARG4 Apoptosis-associated speck-like protein containing a CARD Homo sapiens 0.009775143 8 Escherichia coli-Pichia pastoris shuttle vector pPpARG4 LEVO LHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVED LER helical filament 8. ETHANE
FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 GATAN K2 SUMMIT (4k x 4k) 41.0 1 5.0 -100.58 C1 3.17 FSC 0.143 CUT-OFF 264167 NOT APPLICABLE emd_8902.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 192 192 192 -95 -95 -95 192 192 192 253.44 253.44 253.44 90.0 90.0 90.0 X Y Z -0.3005335 0.5332551 0.0026573783 0.025429418 1.32 1.32 1.32 0.1 AUTHOR Helical reconstruction of ASC-CARD filament