2024-10-09 REL RCSB RCSB RCSB 2016-08-16 2016-08-31 2016-08-31 2024-10-09 National Institutes of Health/National Institute on Aging (NIH/NIA) AG15709-19 United States Architecture of the Yeast Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Sub-Complex Formed by the Iron Donor, Yfh1, and the Scaffold, Isu1 Ranatunga W Gakh O Friedreich Ataxia, frataxin, iron-sulfur protein, mitochondria, protein complex, OXIDOREDUCTASE Ranatunga W Gakh O Galeano BK Smith IV DY Soderberg CA Al-Karadaghi S Thompson JR Isaya G Architecture of the Yeast Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Sub-Complex Formed by the Iron Donor, Yfh1, and the Scaffold, Isu1 J. Biol. Chem. US 291 10378 10398 2016 26941001 doi:10.1074/jbc.M115.712414 0021-9258 0071 JBCHA3 EMD-8301 other EM volume 5t0v FULLOVERLAP Yfh1-Isu1 Yfh1-Isu1 0 1 2
macromolecule comprising 24-mer of Yfh1 and 24-mer of Isu1
Saccharomyces cerevisiae 0.7 Iron sulfur cluster assembly protein 1, mitochondrial Saccharomyces cerevisiae 0.015383871999999998 24 Escherichia coli #1/H766 LEVO GSHMSSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASS SYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTMLS Q03020 Frataxin homolog, mitochondrial Saccharomyces cerevisiae 0.013455976 24 Escherichia coli #1/H766 LEVO VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIW LASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISK Q07540 1.16.3.1 singleParticle particle 0.12 7.3 10.0 C8H19KN2O5S HEPES-KOH 100.0 NaCl sodium chloride NEGATIVE uranyl acetate
Pre-incubated in HN100 buffer, the grid was placed on an 11-microliter drop of protein sample for 1 minute. Excess protein sample was blotted and washed for 3 seconds by placing the grid on a drop of sterile water. After excess water was blotted, the grid was stained with 1% w/v uranyl acetate for 1 second and 30 seconds by successively placing it on two separate drops of uranyl acetate, with excess stain drawn off after each step.
 carbon-coated, EMS COPPER 400 GLOW DISCHARGE
DV-502A instrument, Denton Vacuum Inc.
The protein complex was prepared by incubating Yfh1 and Isu1 (1:1.5 molar ratio) in HN100 buffer (10 mM HEPES-KOH, pH 7.3, 100 mM NaCl) and purified using Sephacryl S300 gel filtration chromatography.
 FEI TECNAI F30 OTHER BRIGHT FIELD FIELD EMISSION GUN 300 2.0 0.21 0.21 2.8000000000000003 2.8000000000000003 115000.0 115000.0 SIDE ENTRY, EUCENTRIC NITROGEN GATAN ULTRASCAN 4000 (4k x 4k) 4096 4096 1 559 30.0 1
432 symmetry applied for reconstruction
4153 O FOURIER SPACE 17.5 FSC 0.143 CUT-OFF EMAN2 2.06 4153 NOT APPLICABLE NOT APPLICABLE emd_8341.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 288 288 288 0 0 0 288 288 288 297.79202 297.79202 297.79202 90.0 90.0 90.0 X Y Z -8.725704 12.439627 0.042547934 0.8003871 1.034 1.034 1.034 0.8 AUTHOR Yfh1_Isu1 sub-complex RIGID BODY FIT REAL