2024-03-06 REL RCSB RCSB RCSB 2016-08-05 2016-08-17 2016-08-17 2024-03-06 National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) U54 GM094598 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R01 GM095747 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) U54 GM094611 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R01 GM118772 United States Coudray N Seyler S boron transporter, anion exchanger family, alternating access mechanism, Structural Genomics, PSI-Biology, Transcontinental EM Initiative for Membrane Protein Structure, TEMIMPS, TRANSPORT PROTEIN Coudray N L Seyler S Lasala R Zhang Z Clark KM Dumont ME Rohou A Beckstein O Stokes DL Protein Sci. US 26 130 145 2017 27717063 doi:10.1002/pro.3061 1469-896X 0795 PRCIEI 5sv9 FULLOVERLAP Bor1p dimer in an inward-facing conformation Bor1p dimer in an inward-facing conformation 0 1 Saccharomyces mikatae 0.06 Bor1p boron transporter Saccharomyces mikatae 0.053829766 2 Saccharomyces cerevisiae LEVO IWLDLKDRIPYYKSDWVDAFNYRVIPSTVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLAGQPLCI VGVTGPISIFNYTVYEIIKPLNTSYFGFMFWICLWSMIFHLLLAFTNVVCLLQYVTTFPCDIFGLFINVVYIQKGIQILT RQFHNTSGEKSVQDGFASVVVALVMTAFGLFFKSFHHYPLFTHKIRTFISDYSTALSVLFWSSFTHFGGYLNDVKFKKLP ITKSFFPTSKFNRPQNTWLAYEPIPVKDVFIALPFGIILTILFYFDHNVSSLMAQRHQYKLRKPSSFHYDFALLGLTTCI SGVLGIPAPNGLIPQAPLHTETLLVRDSNQNVVRCVEQRLTNTFQGLMILGTMTRPLLVCLGEIPQAVLSGLFFIMGING LMTNVIIHRIVFLFSDPKRRDNNSPLAKISKRSMVIFLCFSLAGFTGEFAITNTIAAIGFPLVLLLSVIVSFSFTY helical helicalArray 0.25 7.0 100.0 C8H18N2O4 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid 100.0 NaCl sodium chloride 2.0 H3BO3 boric acid 5.0 NaN3 sodium azide

Buffer was changed twice per day.

EMS COPPER 400 CARBON HOLEY GLOW DISCHARGE 30 OTHER ETHANE 90 HOMEMADE PLUNGER

The protein was solubilized in 1% n-Dodecyl beta-D-maltoside and exchanged into heptaethyleneglycol-n-dodecylether (C12E7) while bound to the IgG Sepharose affinity column.

FEI TECNAI F20 FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 200 2.0 1.0 0.85 2.5 2.7 19000.0 GATAN 626 SINGLE TILT LIQUID NITROGEN CRYO TRANSFER HOLDER NITROGEN GATAN K2 SUMMIT (4k x 4k) SUPER-RESOLUTION 3710 3710 2-27 2 252 6.75 45.0 1 4.8 37.35 C1 5.9 FSC 0.143 CUT-OFF FREALIX 1.2.0 flx_wrap.rb SPARX/EMAN2 EMAN2.1 filt_table and filt_tanl

Reconstruction was done using D1 symmetry because of an existing two-fold symmetry in the unit cells composing the helical lattice. This two-fold axis runs perpendicular to the helical axis. For the final structure, a filter was applied to the map in order to compensate for resolution-dependent amplitude falloff. To do so, we built a model by arranging UraA in a helical assembly in order to mimic the mass distribution in Bor1p tubes. Fourier transforms from this model and from the experimental maps were then rotationally averaged to produce 1D scattering profiles. The resolution-dependent amplitude ratio from these profiles was used as a filter that was applied to the experimental amplitudes using SPARX routines. Finally, a low-pass filter was applied with a 5 Angstrom stop-band frequency.

75 87 SPARX/EMAN2 EMAN2.1 sxhelixboxer.py

Initial model was created using the Fourier-Bessel method using 41 tube sections.

NOT APPLICABLE FREALIX 1.2.0 flx_wrap.rb 4YZF A 418-911 PDB experimental model 4YZF B 418-911 PDB experimental model FLEXIBLE FIT

A homology model was first created using human AE1 (PDB entry 4YZF) as a template using MODELLER, placed into the density map using SITUS, and then fitted into the map using the Molecular Dynamics Flexible Fitting (MDFF) method.

cross-correlation coefficient REAL