2025-03-19 REL PDBj INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY DATABASE_REFERENCES citation citation_author em_admin _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_PubMed _citation_author.identifier_ORCID _em_admin.last_update STRUCTURE_SUMMARY citation citation_author em_admin entity struct struct_ref_seq_dif _citation.page_first _citation.page_last _citation_author.identifier_ORCID _em_admin.last_update _em_admin.title _entity.pdbx_mutation _struct.title _struct_ref_seq_dif.details STRUCTURE_SUMMARY citation citation_author em_admin entity struct_ref_seq_dif _citation.page_first _citation.page_last _citation_author.identifier_ORCID _em_admin.last_update _em_admin.title _entity.pdbx_mutation _struct_ref_seq_dif.details PDBj PDBj 2024-08-20 2025-03-05 2025-03-05 2025-03-19 Japan Society for the Promotion of Science (JSPS) 23K23825 Japan Japan Society for the Promotion of Science (JSPS) 22H02561 Japan Japan Society for the Promotion of Science (JSPS) 19H03170 Japan Japan Society for the Promotion of Science (JSPS) 26291016 Japan Japan Society for the Promotion of Science (JSPS) 22370039 Japan Cryo-EM structure of Aquifex aeolicus RseP E18Q mutant in complex with Fab Asahi K Hirose M Aruga R Kato T Nogi T Intramembrane protease, HYDROLASE Asahi K Hirose M Aruga R Shimizu Y Tajiri M Tanaka T Adachi Y Tanaka Y Kaneko MK Kato Y Akashi S Akiyama Y Hizukuri Y Kato T Nogi T Cryo-EM structure of the bacterial intramembrane metalloprotease RseP in the substrate-bound state. Sci Adv US 11 eadu0925 eadu0925 2025 40009668 doi:10.1126/sciadv.adu0925 2375-2548 9j83 FULLOVERLAP RseP ortholog E18 mutant in complex with 4A9 Fab RseP ortholog E18 mutant in complex with 4A9 Fab 0 1 2 3 4 0.05 Fab of mouse monoclonal antibody IgG 4A9 1 2 3 Mus musculus RseP orhtholog E18 mutant from Aquifex aeolicus 1 1 Aquifex aeolicus (strain VF5) unknown peptide 1 4 Escherichia coli Putative zinc metalloprotease aq_1964 Aquifex aeolicus VF5 0.04932121899999999 1 Escherichia coli LEVO (FME)GLIAFLILIGVLVWVHQFGHFLMAKLFRVKVEIFSIGFGPPIFRRQWGETVYQIAALPLGGYVKLYGEEENVHDP RAFSTKKPWQKILIALGGPLFNFLFTILVFALVYTAGVEVPKYLKEPVVVGYVQRDSIAQKIGIKPGDKIIKI(SNN)GY EVRTWEDLRDALIRLSLDGVKETTLFLERNGEVLHLTIKVPNVQKGEELGIAPLVKPVVGGVKKGSPADQVGIKPGDLIL EVNGKKINTWYELVEEVRKSQGKAIKLKILRNGKMIEKELIPAKDPKTGTYFIGLFPKTETVVEKKPFGEALASAVNRTW ELTVLTLKTIAGLITGKVSFQTLGGPIAIAQIAGQAAQSGFIPYLVMMAFISLQLGIFNLIPLPILDGGLILLFAIEWLR GRPLPEKFKEYWQRVGLAIIITLTIFVFINDILRLLRGRGSHHHHHHHH O67776 3.4.24.- VH-CH1 region of mouse monoclonal antibody IgG 4A9 Mus musculus 0.025564592 1 Homo sapiens LEVO GSEVKLVESGGGLVQPGGSLRLSCVTSGFTFTDYYMSWVRQPPGKALEWLAFIRNKVNGYTTEYRASVKGRFTISRDSSQ SILYLQVNTLRAEDSATYYCARDRGGNGVYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEP VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGGVAMPGAEDDVV L chain of mouse monoclonal antibody IgG 4A9 Mus musculus 0.023734125 1 Homo sapiens LEVO DIVMTQSHKFMSTSVGDRVSITCKASQDVGTDVAWYQQKPGQSPKLLIYWASIRHTGVPDRFTGSGSGTDFTLTISNVQS EDLADYFCQQYSSYPLTFGAGTKLELERADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC unknown peptide Escherichia coli 0.001294587
The peptide is presumed to be a fragment of Escherichia coli membrane protein.
1 Escherichia coli LEVO (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) ZINC ION 6.5409e-05 1 ZN singleParticle particle 7.4 Quantifoil R0.6/1 COPPER 200 CARBON HOLEY GLOW DISCHARGE AIR ETHANE 95 277 FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 50.0 0.024 0.8 0.1 1.8 3.081 105000.0 103703.0 FEI TITAN KRIOS AUTOGRID HOLDER NITROGEN CEOS, spherical aberration corrector GIF Bioquantum 20 GATAN K3 BIOQUANTUM (6k x 4k) 5760 4092 1 15777 3.427 60.0 1 4429254 C1 FOURIER SPACE 3.61 FSC 0.143 CUT-OFF cryoSPARC 4.4.0 120267 MAXIMUM LIKELIHOOD cryoSPARC 4.4.0 MAXIMUM LIKELIHOOD cryoSPARC 4.4.0 3 112949.0 cryoSPARC 4.4.0 emd_61214.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 180 180 180 0 0 0 180 180 180 243.0 243.0 243.0 90.0 90.0 90.0 X Y Z -0.2852864 0.6246102 0.0004902111 0.019147804 1.35 1.35 1.35 0.16 AUTHOR A 1-113 AlphaFold in silico model 6AKQ A 114-206 PDB experimental model 3WKM A 207-298 PDB experimental model A 299-429 AlphaFold in silico model 8ZAY H PDB experimental model 8ZAY L PDB experimental model FLEXIBLE FIT REAL emd_61214_msk_1.map emd_61214_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 180 180 180 0 0 0 180 180 180 243.0 243.0 243.0 90.0 90.0 90.0 X Y Z -0.37623414 0.7919895 0.0009772673 0.025786921 1.35 1.35 1.35 AUTHOR emd_61214_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 180 180 180 0 0 0 180 180 180 243.0 243.0 243.0 90.0 90.0 90.0 X Y Z -0.33813885 0.7835901 0.0009748316 0.025867663 1.35 1.35 1.35 AUTHOR