<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_11_7/emdb.xsd" version="3.0.11.7" emdb_id="EMD-54981">
    <admin>
        <current_status>
            <date>2026-09-02</date>
            <code>REL</code>
            <processing_site>PDBe</processing_site>
        </current_status>
        <revision_history>
            <revision version="1.0" date="2026-09-02">
                <change_list>
                    <model>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </model>
                    <metadata>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </metadata>
                </change_list>
            </revision>
        </revision_history>
        <sites>
            <deposition>PDBe</deposition>
            <last_processing>PDBe</last_processing>
        </sites>
        <key_dates>
            <deposition>2025-09-02</deposition>
            <header_release>2026-09-02</header_release>
            <map_release>2026-09-02</map_release>
            <update>2026-09-02</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>Biotechnology and Biological Sciences Research Council (BBSRC)</funding_body>
                <code>BB/M024709/1</code>
                <country>United Kingdom</country>
            </grant_reference>
            <grant_reference>
                <funding_body>F. Hoffmann-La Roche LTD</funding_body>
                <country>Switzerland</country>
            </grant_reference>
        </grant_support>
        <title>GABA-A a4b3d receptor in complex with GABA, Nb24 and Mb30</title>
        <authors_list>
            <author>Nestorow S</author>
            <author>Miller PS</author>
        </authors_list>
        <keywords>pLGIC, GABA, Neurotransmission, Extrasynaptic, MEMBRANE PROTEIN</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author order="1">Nestorow SA</author>
                    <author order="2">Chen WN</author>
                    <author order="3">Bertrand D</author>
                    <author order="4">Wahid AA</author>
                    <author order="5">Wyatt CE</author>
                    <author order="6">Mortensen M</author>
                    <author order="7">Clairfeuille T</author>
                    <author order="8">Reutlinger M</author>
                    <author order="9">Friz G</author>
                    <author order="10">Pardon E</author>
                    <author order="11">Steyaert J</author>
                    <author order="12">Ladds G</author>
                    <author order="13">Cecere G</author>
                    <author order="14">Smart TG</author>
                    <author order="15">Hernandez MC</author>
                    <author order="16">Joedicke L</author>
                    <author order="17">Miller PS</author>
                    <title>Molecular arrangement and modulation of extrasynaptic alpha beta delta GABAA receptors</title>
                    <journal_abbreviation>Nat Commun</journal_abbreviation>
                    <country>UK</country>
                    <year>2026</year>
                    <external_references type="DOI">doi:10.1038/s41467-026-76879-5</external_references>
                    <external_references type="ISSN">2041-1723</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>9sl1</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
        <other_db_list>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-54981</accession_id>
                <content_type>associated EM volume</content_type>
                <details>GABA-A a4b3d receptor in complex with GABA, Nb24 and Mb30</details>
            </db_reference>
        </other_db_list>
    </crossreferences>
    <sample>
        <name>alpha4-beta3-delta GABA-A receptor in complex with GABA, nanobody Nb24 and megabody Mb30</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>alpha4-beta3-delta GABA-A receptor in complex with GABA, nanobody Nb24 and megabody Mb30</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>4</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>5</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <details>The heteropentameric alpha4beta3delta GABA(A) receptor was recombinantly expressed in Expi293 cells. Constructs were engineered with the M3- M4 intracellular domain replaced either by a GLVI linker sequence (SQPARAA) or by a modified GLVI sequence containing Escherichia coli cytochrome B562RIL41. The sample was prepared in the presence of GABA, nanobody Nb24, and megabody Mb30.</details>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="2">
                <name>GABA-A receptor</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="3">
                <name>Megabody Mb30</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>4</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9844">Lama glama</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="4">
                <name>Nanobody Nb24</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>5</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9844">Lama glama</organism>
                </natural_source>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>Gamma-aminobutyric acid receptor subunit alpha-4</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.041783336000000004</theoretical>
                </molecular_weight>
                <details>Glvi linker sequence (SQPARAA) substituted between Ile311-Ser481. M120T mutation.,Glvi linker sequence (SQPARAA) substituted between Ile311-Ser481. M120T mutation.,Glvi linker sequence (SQPARAA) substituted between Ile311-Ser481. M120T mutation.,Glvi linker sequence (SQPARAA) substituted between Ile311-Ser481. M120T mutation.</details>
                <number_of_copies>2</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>GNSKDEKLCPENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIE
ILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRITRNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAY
PKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQ
VSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNSQPARAAKID
KYARILFPVTFGAFNMVYWVVYLSKDTMEKSESLMGTKHHHHHH</string>
                    <external_references type="UNIPROTKB">P48169</external_references>
                    <external_references type="UNIPROTKB">P48169</external_references>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="2">
                <name>Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.051615116999999995</theoretical>
                </molecular_weight>
                <details>Modified glvi sequence containing the Escherichia coli soluble cytochrome B562RIL41 (BRIL, amino acids 23-130, ADLE...QKYL, Uniprot P0ABE7) to give the sequence SQPAGT-BRIL-TGRAA. Linker regions substituted Gly308-Asn421. This BRIL domain was present in the protein but not resolved in the cryo-EM density and is therefore not included in the atomic model.,Modified glvi sequence containing the Escherichia coli soluble cytochrome B562RIL41 (BRIL, amino acids 23-130, ADLE...QKYL, Uniprot P0ABE7) to give the sequence SQPAGT-BRIL-TGRAA. Linker regions substituted Gly308-Asn421. This BRIL domain was present in the protein but not resolved in the cryo-EM density and is therefore not included in the atomic model.,Modified glvi sequence containing the Escherichia coli soluble cytochrome B562RIL41 (BRIL, amino acids 23-130, ADLE...QKYL, Uniprot P0ABE7) to give the sequence SQPAGT-BRIL-TGRAA. Linker regions substituted Gly308-Asn421. This BRIL domain was present in the protein but not resolved in the cryo-EM density and is therefore not included in the atomic model.,Modified glvi sequence containing the Escherichia coli soluble cytochrome B562RIL41 (BRIL, amino acids 23-130, ADLE...QKYL, Uniprot P0ABE7) to give the sequence SQPAGT-BRIL-TGRAA. Linker regions substituted Gly308-Asn421. This BRIL domain was present in the protein but not resolved in the cryo-EM density and is therefore not included in the atomic model.,Modified glvi sequence containing the Escherichia coli soluble cytochrome B562RIL41 (BRIL, amino acids 23-130, ADLE...QKYL, Uniprot P0ABE7) to give the sequence SQPAGT-BRIL-TGRAA. Linker regions substituted Gly308-Asn421. This BRIL domain was present in the protein but not resolved in the cryo-EM density and is therefore not included in the atomic model.,Modified glvi sequence containing the Escherichia coli soluble cytochrome B562RIL41 (BRIL, amino acids 23-130, ADLE...QKYL, Uniprot P0ABE7) to give the sequence SQPAGT-BRIL-TGRAA. Linker regions substituted Gly308-Asn421. This BRIL domain was present in the protein but not resolved in the cryo-EM density and is therefore not included in the atomic model.</details>
                <number_of_copies>2</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLN
LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYT
TDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFSQPAGTADLEDNW
ETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEA
QAAAEQLKTTRNAYIQKYLTGRAAAIDRWSRIVFPFTFSLFNLVYWLYYVN</string>
                    <external_references type="UNIPROTKB">P28472</external_references>
                    <external_references type="UNIPROTKB">P0ABE7</external_references>
                    <external_references type="UNIPROTKB">P28472</external_references>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="3">
                <name>GABA-A receptor SBP-delta-glvi,Gamma-aminobutyric acid receptor subunit delta,Gamma-aminobutyric acid receptor subunit delta</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.048233961</theoretical>
                </molecular_weight>
                <details>Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.,Includes an SBP tag at start of the sequence, this is not resolved in density and not modelled. Glvi linker sequence (SQPARAA) substituted between Asp312-Asp401.</details>
                <number_of_copies>1</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>MGILPSPGMPALLSLVSLLSVLLMGCVAEMDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPDYDIPTTENLYFQ
GTGAMNDIGDYVGSNLEISWLPNLDGLIAGYARNFRPGIGGPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRL
SYNHTNETLGLDSRFVDKLWLPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML
DLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLHFHLRRNRGVYIIQSYMPSVL
LVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSSLPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADSQPA
RAATIDIYARAVFPAAFAAVNVIYWAAYAM</string>
                    <external_references type="UNIPROTKB">O14764</external_references>
                    <external_references type="UNIPROTKB">O14764</external_references>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="4">
                <name>Megabody Mb30</name>
                <natural_source database="NCBI">
                    <organism ncbi="9844">Lama glama</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.015386944999999999</theoretical>
                </molecular_weight>
                <details>This nanobody was expressed as part of a megabody fusion construct. The scaffold domain of the megabody was present in the construct but was disordered in the cryo-EM density and therefore not included in the atomic model. Only the nanobody sequence is provided in the deposited coordinates.</details>
                <number_of_copies>2</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="562">Escherichia coli</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QVQLQESGGGLVQGSLRLSCTASQLTFSNYHMAWFRQLPGKEREFVAAISAGWGGNTAYGTSIRGRFTISRDDAKNTAYL
QMNSLKPEDTAVYYCAARNAVRPSWFAVKQTESAYDYWGQGTQVTVSSHHHHHHEPEA</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="5">
                <name>Nanobody Nb24</name>
                <natural_source database="NCBI">
                    <organism ncbi="9844">Lama glama</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.014689062</theoretical>
                </molecular_weight>
                <number_of_copies>2</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QVQLQESGGGLVQAGDSLRLSCAASGRSIRNYHMGWFRQAPGKERDFVAAILWSGSSTFYADSVKGRFTVSRDNAKNTVY
LQMNSLKPEDTAVYYCALHRGGSEDSPQAYDSWGQGTQVTVSSHHHHHHEPEA</string>
                </sequence>
            </protein_or_peptide>
            <ligand macromolecule_id="8">
                <name>2-acetamido-2-deoxy-beta-D-glucopyranose</name>
                <molecular_weight>
                    <theoretical units="MDa">0.000221208</theoretical>
                </molecular_weight>
                <number_of_copies>7</number_of_copies>
                <formula>NAG</formula>
            </ligand>
            <ligand macromolecule_id="9">
                <name>1,2-DIPALMITOYL-SN-GLYCERO-3-PHOSPHATE</name>
                <molecular_weight>
                    <theoretical units="MDa">0.000647883</theoretical>
                </molecular_weight>
                <number_of_copies>1</number_of_copies>
                <formula>PX6</formula>
            </ligand>
            <ligand macromolecule_id="10">
                <name>DECANE</name>
                <molecular_weight>
                    <theoretical units="MDa">0.000142282</theoretical>
                </molecular_weight>
                <number_of_copies>4</number_of_copies>
                <formula>D10</formula>
            </ligand>
            <ligand macromolecule_id="11">
                <name>GAMMA-AMINO-BUTANOIC ACID</name>
                <molecular_weight>
                    <theoretical units="MDa">0.00010312</theoretical>
                </molecular_weight>
                <number_of_copies>2</number_of_copies>
                <formula>ABU</formula>
            </ligand>
            <ligand macromolecule_id="12">
                <name>water</name>
                <molecular_weight>
                    <theoretical units="MDa">1.8015e-05</theoretical>
                </molecular_weight>
                <number_of_copies>2</number_of_copies>
                <formula>HOH</formula>
            </ligand>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <buffer>
                        <ph>7.6</ph>
                        <details>75 millimolar sodium chloride; 12.5 millimolar HEPES, pH 7.6; 10 millimolar biotin</details>
                    </buffer>
                    <grid>
                        <model>UltrAuFoil R1.2/1.3</model>
                        <material>GOLD</material>
                        <mesh>300</mesh>
                        <support_film film_type_id="1">
                            <film_material>GOLD</film_material>
                            <film_topology>HOLEY</film_topology>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">60</time>
                            <atmosphere>AIR</atmosphere>
                            <pressure units="kPa">0.039</pressure>
                        </pretreatment>
                    </grid>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                        <chamber_humidity units="percentage">95</chamber_humidity>
                        <chamber_temperature units="K">277</chamber_temperature>
                        <instrument>FEI VITROBOT MARK IV</instrument>
                    </vitrification>
                    <details>Nanodisc-reconstituted alpha4beta3delta GABA-A receptor in complex with GABA, nanobody Nb24 and megabody Mb30</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>TFS KRIOS</microscope>
                    <illumination_mode>OTHER</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <c2_aperture_diameter units="µm">50.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.7</nominal_cs>
                    <nominal_defocus_min units="µm">0.8</nominal_defocus_min>
                    <nominal_defocus_max units="µm">2.2</nominal_defocus_max>
                    <nominal_magnification>165000.0</nominal_magnification>
                    <specimen_holder_model>FEI TITAN KRIOS AUTOGRID HOLDER</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>FEI FALCON IV (4k x 4k)</film_or_detector_model>
                            <number_real_images>6975</number_real_images>
                            <average_exposure_time units="s">4.39</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">51.12</average_electron_dose_per_image>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <particle_selection>
                    <number_selected>807577</number_selected>
                </particle_selection>
                <ctf_correction>
                    <software_list>
                        <software>
                            <name>ARP/wARP</name>
                            <version>1.0.9</version>
                        </software>
                    </software_list>
                    <type>PHASE FLIPPING AND AMPLITUDE CORRECTION</type>
                </ctf_correction>
                <startup_model type_of_model="NONE">
                    <details>An ab initio 3D reconstruction was generated from experimental 2D class averages in cryoSPARC without the use of any external reference, and was used as the startup model for future refinements.</details>
                </startup_model>
                <final_reconstruction>
                    <applied_symmetry>
                        <point_group>C1</point_group>
                    </applied_symmetry>
                    <resolution units="Å" res_type="BY AUTHOR">2.68</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.4.1 to 4.7.1</version>
                        </software>
                    </software_list>
                    <number_images_used>117418</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>PROJECTION MATCHING</type>
                    <projection_matching_processing/>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.4.1 to 4.7.1</version>
                        </software>
                    </software_list>
                    <details>Particle orientations were assigned by projection matching during iterative refinement in cryoSPARC.</details>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>PROJECTION MATCHING</type>
                    <projection_matching_processing/>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.4.1 to 4.7.1</version>
                        </software>
                    </software_list>
                    <details>Final orientations determined by projection matching during non-uniform refinement in cryoSPARC.</details>
                </final_angle_assignment>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="442369">
        <file>emd_54981.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>480</col>
            <row>480</row>
            <sec>480</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>480</x>
            <y>480</y>
            <z>480</z>
        </spacing>
        <cell>
            <a units="Å">349.91998</a>
            <b units="Å">349.91998</b>
            <c units="Å">349.91998</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.16920006</minimum>
            <maximum>0.4318445</maximum>
            <average>0.00070861104</average>
            <std>0.008766935</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">0.729</x>
            <y units="Å">0.729</y>
            <z units="Å">0.729</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.0754</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-54981::::</label>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <initial_model>
                    <access_code>7QN7</access_code>
                    <chain>
                        <source_name>PDB</source_name>
                        <initial_model_type>experimental model</initial_model_type>
                    </chain>
                </initial_model>
            </modelling>
        </modelling_list>
        <segmentation_list>
            <segmentation>
                <file>emd_54981_msk_1.map</file>
            </segmentation>
        </segmentation_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="442369">
                <file>emd_54981_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>480</col>
                    <row>480</row>
                    <sec>480</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>480</x>
                    <y>480</y>
                    <z>480</z>
                </spacing>
                <cell>
                    <a units="Å">349.91998</a>
                    <b units="Å">349.91998</b>
                    <c units="Å">349.91998</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.3845905</minimum>
                    <maximum>0.6598904</maximum>
                    <average>0.00054931594</average>
                    <std>0.041078962</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.729</x>
                    <y units="Å">0.729</y>
                    <z units="Å">0.729</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-54981::::</label>
            </half_map>
            <half_map format="CCP4" size_kbytes="442369">
                <file>emd_54981_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>480</col>
                    <row>480</row>
                    <sec>480</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>480</x>
                    <y>480</y>
                    <z>480</z>
                </spacing>
                <cell>
                    <a units="Å">349.91998</a>
                    <b units="Å">349.91998</b>
                    <c units="Å">349.91998</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.37008524</minimum>
                    <maximum>0.6373544</maximum>
                    <average>0.000548704</average>
                    <std>0.0409998</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.729</x>
                    <y units="Å">0.729</y>
                    <z units="Å">0.729</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-54981::::</label>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
