<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_11_0/emdb.xsd" version="3.0.11.0" emdb_id="EMD-54973">
    <admin>
        <current_status>
            <date>2026-04-22</date>
            <code>REL</code>
            <processing_site>PDBe</processing_site>
        </current_status>
        <revision_history>
            <revision version="1.0" date="2026-04-22">
                <change_list>
                    <model>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </model>
                    <metadata>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </metadata>
                    <fsc>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </fsc>
                    <half_map part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </half_map>
                    <half_map part="2">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </half_map>
                    <image>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </image>
                    <mask part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </mask>
                    <mask part="2">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </mask>
                    <primary_map>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </primary_map>
                </change_list>
            </revision>
        </revision_history>
        <sites>
            <deposition>PDBe</deposition>
            <last_processing>PDBe</last_processing>
        </sites>
        <key_dates>
            <deposition>2025-09-02</deposition>
            <header_release>2026-04-22</header_release>
            <map_release>2026-04-22</map_release>
            <update>2026-04-22</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>Swedish Research Council</funding_body>
                <code>2019-03700_VR</code>
                <country>Sweden</country>
            </grant_reference>
            <grant_reference>
                <funding_body>Formas, a Swedish research council for sustainable development</funding_body>
                <code>2019-01171_Formas</code>
                <country>Sweden</country>
            </grant_reference>
            <grant_reference>
                <funding_body>Swedish Research Council</funding_body>
                <code>2023-05296_VR</code>
                <country>Sweden</country>
            </grant_reference>
        </grant_support>
        <title>Cryo-EM structure of H. neapolitanus CsoSCA in oxidizing conditions, dimer, major state, active conformation</title>
        <authors_list>
            <author>Gaullier G</author>
            <author>Vogiatzi N</author>
            <author>Blikstad C</author>
        </authors_list>
        <keywords>Carbonic anhydrase, carboxysome, CO2 concentration mechanism, LYASE</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author order="1">Vogiatzi N</author>
                    <author order="2">Gaullier G</author>
                    <author order="3">Leufstadius J</author>
                    <author order="4">Andersson T</author>
                    <author order="5">Scherbauer T</author>
                    <author order="6">Blikstad C</author>
                    <title>Molecular mechanism of redox regulation of the alpha-carboxysomal carbonic anhydrase CsoSCA</title>
                    <journal_abbreviation>Biorxiv</journal_abbreviation>
                    <country>US</country>
                    <year>2026</year>
                    <external_references type="DOI">doi:10.64898/2026.04.02.716132</external_references>
                    <external_references type="ISSN">2692-8205</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>9sks</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
        <other_db_list>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-54973</accession_id>
                <content_type>associated EM volume</content_type>
                <details>Cryo-EM structure of H. neapolitanus CsoSCA in oxidizing conditions, dimer, major state, active conformation</details>
            </db_reference>
        </other_db_list>
    </crossreferences>
    <sample>
        <name>HnCsoSCA</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>HnCsoSCA</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="555778">Halothiobacillus neapolitanus c2</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.61154982</theoretical>
                </molecular_weight>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>Maltose/maltodextrin-binding periplasmic protein,Carboxysome shell carbonic anhydrase</name>
                <natural_source database="NCBI">
                    <organism ncbi="555778">Halothiobacillus neapolitanus c2</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.10204477299999999</theoretical>
                </molecular_weight>
                <details>This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.,This is a fusion protein with an N-terminal Strep-MBP tag and a TEV protease site between the MBP tag and CsoSCA. The MBP tag and the disordered N-terminus of CsoSCA are not visible in the map.</details>
                <number_of_copies>2</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="511693">Escherichia coli BL21</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>MWSHPQFEKGSSMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRF
GGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSAL
MFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTIN
GPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSY
EEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEENL
YFQSNANTRNTRSKQRAPFGVSSSVKPRLDLIEQAPNPAYDRHPACITLPERTCRHPLTDLEANEQLGRCEDSVKNRFDR
VIPFLQVVAGIPLGLDYVTRVQELAQSSLGHTLPEELLKDNWISGHNLKGIFGYATAKALTAATEQFSRKIMSEKDDSAS
AIGFFLDCGFHAVDISPCADGRLKGLLPYILRLPLTAFTYRKAYAGSMFDIEDDLAQWEKNELRRYREGVPNTADQPTRY
LKIAVYHFSTSDPTHSGCAAHGSNDRAALEAALTQLMKFREAVENAHCCGASIDILLIGVDTDTDAIRVHIPDSKGFLNP
YRYVDNTVTYAQTLHLAPDEARVIIHEAILNANRSDGWAKGNGVASEGMRRFIGQLLINNLSQIDYVVNRHGGRYPPNDI
GHAERYISVGDGFDEVQIRNLAYYAHLDTVEENAIDVDVGIKIFTKLNLSRGLPIPIAIHYRYDPNVPGSRERTVVKARR
IYNAIKERFSSLDEQNLLQFRLSVQAQDIGSPIEEVASA</string>
                    <external_references type="UNIPROTKB">P0AEX9</external_references>
                    <external_references type="UNIPROTKB">O85042</external_references>
                </sequence>
                <ec_number>4.2.1.1</ec_number>
            </protein_or_peptide>
            <ligand macromolecule_id="2">
                <name>ZINC ION</name>
                <molecular_weight>
                    <theoretical units="MDa">6.5409e-05</theoretical>
                </molecular_weight>
                <number_of_copies>2</number_of_copies>
                <formula>ZN</formula>
            </ligand>
            <ligand macromolecule_id="3">
                <name>water</name>
                <molecular_weight>
                    <theoretical units="MDa">1.8015e-05</theoretical>
                </molecular_weight>
                <number_of_copies>361</number_of_copies>
                <formula>HOH</formula>
            </ligand>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <concentration units="mg/mL">0.428</concentration>
                    <buffer>
                        <ph>7.5</ph>
                        <component>
                            <concentration units="mM">50.0</concentration>
                            <name>Tris</name>
                        </component>
                        <component>
                            <concentration units="mM">150.0</concentration>
                            <formula>NaCl</formula>
                            <name>sodium chloride</name>
                        </component>
                    </buffer>
                    <grid>
                        <model>Quantifoil R1.2/1.3</model>
                        <material>COPPER</material>
                        <mesh>300</mesh>
                        <support_film film_type_id="1">
                            <film_material>CARBON</film_material>
                            <film_topology>HOLEY ARRAY</film_topology>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">60</time>
                            <atmosphere>OTHER</atmosphere>
                            <pressure units="kPa">0.04</pressure>
                        </pretreatment>
                        <details>Performed with a Pelco easiGlow with a current of 20 mA.</details>
                    </grid>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                        <chamber_humidity units="percentage">100</chamber_humidity>
                        <chamber_temperature units="K">277.15</chamber_temperature>
                        <instrument>FEI VITROBOT MARK IV</instrument>
                        <details>4C, 100% relative humidity, delay time 0s, blot time 3s, blot force 0. </details>
                    </vitrification>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>TFS KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <c2_aperture_diameter units="µm">50.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.7</nominal_cs>
                    <nominal_defocus_min units="µm">0.6</nominal_defocus_min>
                    <nominal_defocus_max units="µm">1.8</nominal_defocus_max>
                    <nominal_magnification>130000.0</nominal_magnification>
                    <specimen_holder_model>FEI TITAN KRIOS AUTOGRID HOLDER</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <alignment_procedure>
                        <coma_free/>
                    </alignment_procedure>
                    <specialist_optics>
                        <energy_filter>
                            <name>GIF Bioquantum</name>
                            <slit_width units="eV">20</slit_width>
                        </energy_filter>
                    </specialist_optics>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>GATAN K3 BIOQUANTUM (6k x 4k)</film_or_detector_model>
                            <number_grids_imaged>1</number_grids_imaged>
                            <number_real_images>10002</number_real_images>
                            <average_exposure_time units="s">1.6</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">64.757</average_electron_dose_per_image>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <particle_selection>
                    <number_selected>917605</number_selected>
                    <details>Particles were picked with topaz, trained with a set of about 1000 particles picked manually from micrographs denoised by CryoSPARC. Topaz was trained and applied on raw micrographs.

This is the number of hexamer particles.</details>
                </particle_selection>
                <ctf_correction>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.7</version>
                        </software>
                    </software_list>
                    <type>PHASE FLIPPING AND AMPLITUDE CORRECTION</type>
                </ctf_correction>
                <startup_model type_of_model="OTHER">
                    <details>Ab initio reconstruction from the data, using the SGD-based job in CryoSPARC.</details>
                </startup_model>
                <final_reconstruction>
                    <number_classes_used>3</number_classes_used>
                    <applied_symmetry>
                        <point_group>C1</point_group>
                    </applied_symmetry>
                    <algorithm>FOURIER SPACE</algorithm>
                    <resolution units="Å" res_type="BY AUTHOR">2.15</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.7</version>
                        </software>
                    </software_list>
                    <details>The final reconstruction was produced by classifying dimers, regrouping similar 3D classes, and running local refinement with signal-subtracted particle images.</details>
                    <number_images_used>574591</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.7</version>
                        </software>
                    </software_list>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.7</version>
                        </software>
                    </software_list>
                    <details>Non-uniform refinement in CryoSPARC.</details>
                </final_angle_assignment>
                <final_three_d_classification>
                    <number_classes>10</number_classes>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>4.7</version>
                        </software>
                    </software_list>
                    <details>These particles are dimers, obtained from C3 symmetry expansion of the hexamers.</details>
                </final_three_d_classification>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="442369">
        <file>emd_54973.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>480</col>
            <row>480</row>
            <sec>480</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>480</x>
            <y>480</y>
            <z>480</z>
        </spacing>
        <cell>
            <a units="Å">312.0</a>
            <b units="Å">312.0</b>
            <c units="Å">312.0</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.3575243</minimum>
            <maximum>0.47497195</maximum>
            <average>0.000092329836</average>
            <std>0.01074767</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">0.65</x>
            <y units="Å">0.65</y>
            <z units="Å">0.65</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.06</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-54973::::</label>
        <annotation_details>Sharpened map from final local refinement in CryoSPARC. Sharpening B-factor: -58.4 A^2.</annotation_details>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <initial_model>
                    <access_code>AF-O85042-F1</access_code>
                    <chain>
                        <source_name>AlphaFold</source_name>
                        <initial_model_type>in silico model</initial_model_type>
                    </chain>
                </initial_model>
                <refinement_protocol>FLEXIBLE FIT</refinement_protocol>
                <refinement_space>RECIPROCAL</refinement_space>
            </modelling>
        </modelling_list>
        <segmentation_list>
            <segmentation>
                <file>emd_54973_msk_2.map</file>
            </segmentation>
            <segmentation>
                <file>emd_54973_msk_1.map</file>
            </segmentation>
        </segmentation_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="442369">
                <file>emd_54973_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>480</col>
                    <row>480</row>
                    <sec>480</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>480</x>
                    <y>480</y>
                    <z>480</z>
                </spacing>
                <cell>
                    <a units="Å">312.0</a>
                    <b units="Å">312.0</b>
                    <c units="Å">312.0</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.15711991</minimum>
                    <maximum>0.21149696</maximum>
                    <average>0.000067698966</average>
                    <std>0.019652022</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.65</x>
                    <y units="Å">0.65</y>
                    <z units="Å">0.65</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-54973::::</label>
                <annotation_details>Half-map B from final local refinement in CryoSPARC.</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="442369">
                <file>emd_54973_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>480</col>
                    <row>480</row>
                    <sec>480</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>480</x>
                    <y>480</y>
                    <z>480</z>
                </spacing>
                <cell>
                    <a units="Å">312.0</a>
                    <b units="Å">312.0</b>
                    <c units="Å">312.0</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.16882303</minimum>
                    <maximum>0.21318066</maximum>
                    <average>0.00006697095</average>
                    <std>0.019660855</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">0.65</x>
                    <y units="Å">0.65</y>
                    <z units="Å">0.65</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-54973::::</label>
                <annotation_details>Half-map A from final local refinement in CryoSPARC.</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
