<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_11_0/emdb.xsd" version="3.0.11.0" emdb_id="EMD-49821">
    <admin>
        <current_status>
            <date>2026-06-17</date>
            <code>REL</code>
            <processing_site>RCSB</processing_site>
        </current_status>
        <revision_history>
            <revision version="1.0" date="2026-04-01">
                <change_list>
                    <model>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </model>
                    <metadata>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </metadata>
                    <additional_map part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </additional_map>
                    <fsc>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </fsc>
                    <half_map part="1">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </half_map>
                    <half_map part="2">
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </half_map>
                    <image>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </image>
                    <primary_map>
                        <revision_type>INITIAL_RELEASE</revision_type>
                        <provider>REPOSITORY</provider>
                    </primary_map>
                </change_list>
            </revision>
            <revision version="1.1" date="2026-06-17">
                <change_list>
                    <model>
                        <revision_group>DATABASE_REFERENCES</revision_group>
                        <categories>
                            <category>citation</category>
                            <category>citation_author</category>
                            <category>em_admin</category>
                        </categories>
                        <items>
                            <item>_citation.country</item>
                            <item>_citation.journal_abbrev</item>
                            <item>_citation.journal_id_CSD</item>
                            <item>_citation.journal_id_ISSN</item>
                            <item>_citation.journal_volume</item>
                            <item>_citation.pdbx_database_id_DOI</item>
                            <item>_citation.pdbx_database_id_PubMed</item>
                            <item>_citation.title</item>
                            <item>_citation.year</item>
                            <item>_citation_author.identifier_ORCID</item>
                            <item>_citation_author.name</item>
                            <item>_em_admin.last_update</item>
                        </items>
                    </model>
                    <metadata>
                        <revision_group>EXPERIMENTAL_SUMMARY</revision_group>
                        <categories>
                            <category>citation</category>
                            <category>citation_author</category>
                            <category>em_admin</category>
                        </categories>
                        <items>
                            <item>_citation.country</item>
                            <item>_citation.journal_abbrev</item>
                            <item>_citation.journal_id_CSD</item>
                            <item>_citation.journal_id_ISSN</item>
                            <item>_citation.journal_volume</item>
                            <item>_citation.pdbx_database_id_DOI</item>
                            <item>_citation.pdbx_database_id_PubMed</item>
                            <item>_citation.title</item>
                            <item>_citation.year</item>
                            <item>_citation_author.identifier_ORCID</item>
                            <item>_citation_author.name</item>
                            <item>_em_admin.last_update</item>
                        </items>
                    </metadata>
                </change_list>
            </revision>
        </revision_history>
        <sites>
            <deposition>RCSB</deposition>
            <last_processing>RCSB</last_processing>
        </sites>
        <key_dates>
            <deposition>2025-03-19</deposition>
            <header_release>2026-04-01</header_release>
            <map_release>2026-04-01</map_release>
            <update>2026-06-17</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)</funding_body>
                <code>R35GM136313</code>
                <country>United States</country>
            </grant_reference>
            <grant_reference>
                <funding_body>National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)</funding_body>
                <code>P20GM152281</code>
                <country>United States</country>
            </grant_reference>
            <grant_reference>
                <funding_body>National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)</funding_body>
                <code>P20GM103429</code>
                <country>United States</country>
            </grant_reference>
        </grant_support>
        <title>SsoPfMCM:DNA class 2a from DNA 2</title>
        <authors_list>
            <author>Enemark EJ</author>
            <author>Rasouli S</author>
            <author>Myasnikov A</author>
        </authors_list>
        <keywords>DNA replication, helicase, MCM, REPLICATION</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author ORCID="0009-0003-3763-3899" order="1">Rasouli S</author>
                    <author ORCID="0000-0003-2607-7121" order="2">Myasnikov A</author>
                    <author ORCID="0000-0003-4055-633X" order="3">Enemark EJ</author>
                    <title>Archaeal and eukaryotic MCM rings sequentially melt DNA for replication initiation.</title>
                    <journal_abbreviation>Nat Commun</journal_abbreviation>
                    <country>UK</country>
                    <volume>17</volume>
                    <year>2026</year>
                    <external_references type="PUBMED">41916983</external_references>
                    <external_references type="DOI">doi:10.1038/s41467-026-70961-8</external_references>
                    <external_references type="ISSN">2041-1723</external_references>
                </journal_citation>
            </primary_citation>
            <secondary_citation>
                <journal_citation published="true">
                    <author ORCID="0000-0003-3921-3209" order="4">Liebschner D</author>
                    <author ORCID="0000-0002-5052-991X" order="5">Afonine PV</author>
                    <author order="6">Baker ML</author>
                    <author order="7">Bunkoczi G</author>
                    <author ORCID="0000-0003-2492-979X" order="8">Chen VB</author>
                    <author order="9">Croll TI</author>
                    <author ORCID="0000-0002-4871-2096" order="10">Hintze B</author>
                    <author ORCID="0000-0001-6690-8458" order="11">Hung LW</author>
                    <author order="12">Jain S</author>
                    <author order="13">McCoy AJ</author>
                    <author ORCID="0000-0001-8857-9464" order="14">Moriarty NW</author>
                    <author ORCID="0000-0003-3107-2202" order="15">Oeffner RD</author>
                    <author ORCID="0000-0001-9633-6067" order="16">Poon BK</author>
                    <author order="17">Prisant MG</author>
                    <author ORCID="0000-0001-8273-0047" order="18">Read RJ</author>
                    <author ORCID="0000-0002-3311-2944" order="19">Richardson JS</author>
                    <author order="20">Richardson DC</author>
                    <author ORCID="0000-0002-8346-9247" order="21">Sammito MD</author>
                    <author ORCID="0000-0002-0623-3214" order="22">Sobolev OV</author>
                    <author order="23">Stockwell DH</author>
                    <author ORCID="0000-0001-6384-0320" order="24">Terwilliger TC</author>
                    <author order="25">Urzhumtsev AG</author>
                    <author order="26">Videau LL</author>
                    <author order="27">Williams CJ</author>
                    <author ORCID="0000-0001-9333-8219" order="28">Adams PD</author>
                    <title>Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix</title>
                    <journal_abbreviation>Acta Crystallogr., Sect. D: Biol. Crystallogr.</journal_abbreviation>
                    <country>DK</country>
                    <volume>75</volume>
                    <first_page>861</first_page>
                    <last_page>877</last_page>
                    <year>2019</year>
                    <external_references type="PUBMED">31588918</external_references>
                    <external_references type="DOI">doi:10.1107/S2059798319011471</external_references>
                    <external_references type="ISSN">0907-4449</external_references>
                    <external_references type="CSD">0766</external_references>
                    <external_references type="ASTM">ABCRE6</external_references>
                </journal_citation>
            </secondary_citation>
        </citation_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>9nuw</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
        <other_db_list>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUH</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 1a, Merged Particles</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUI</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 1b, Merged Particles</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUJ</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 1c, Merged Particles</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUK</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 2a, Merged Particles</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUL</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 2b, Merged Particles</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUM</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 3, Merged Particles</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUN</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 1a, DNA 1</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUO</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 1b, DNA 1</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUP</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 1c, DNA 1</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUQ</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 2a, DNA 1</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUR</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 2b, DNA 1</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUS</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA Class 3, DNA 1</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUT</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA class 1a from DNA 2</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUU</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA class 1b from DNA 2</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUV</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA class 1c from DNA 2</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUX</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA class 2b from DNA 2</details>
            </db_reference>
            <db_reference>
                <db_name>PDB</db_name>
                <accession_id>9NUY</accession_id>
                <content_type>unspecified</content_type>
                <details>SsoPfMCM:DNA class 3 from DNA 2</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-49821</accession_id>
                <content_type>associated EM volume</content_type>
                <details>SsoPfMCM:DNA class 2a from DNA 2</details>
            </db_reference>
        </other_db_list>
    </crossreferences>
    <sample>
        <name>Complex of MCM hexamer with DNA and Mg/ATP-gammaS</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Complex of MCM hexamer with DNA and Mg/ATP-gammaS</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <details>MCM is a Chimeric fusion of Saccharolobus solfataricus MCM N-terminal domain with Pyrococcus furious MCM ATPase domain</details>
                <natural_source database="NCBI">
                    <organism ncbi="273057">Saccharolobus solfataricus P2</organism>
                </natural_source>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>Minichromosome maintenance protein MCM, Cell division control protein 21,DNA helicase</name>
                <natural_source database="NCBI">
                    <organism ncbi="273057">Saccharolobus solfataricus P2</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.069472336</theoretical>
                </molecular_weight>
                <details>N-term Saccharolobus solfataricus P2, ATPase Pyrococcus furiosus DSM 3638 The protein construct exactly matches that of PDB 4R7Y. This is a chimeric fusion of the Saccharolobus solfataricus MCM N-terminal domain (SsoMCM amino acids 1-269) with the Pyrococcus furious MCM ATPase domain (PfMCM amino acids 257-361/729-966). The native PfMCM has an intein (PfMCM aa 362-728) that is removed. The expression construct for this protein has genetically removed the intein. To simplify model building and refinement, all amino acids were numbered sequentially based on the the SsoMCM sequence. Could the PfMCM portion have its amino acid numbers updated to match PDB 4R7Y? Segment 1: Current: (Q270-L374). Add 987. New: (Q1257-L1361) Segment 2: Current: (T375-D612). Add 1354. New: (T1729-D1966),N-term Saccharolobus solfataricus P2, ATPase Pyrococcus furiosus DSM 3638 The protein construct exactly matches that of PDB 4R7Y. This is a chimeric fusion of the Saccharolobus solfataricus MCM N-terminal domain (SsoMCM amino acids 1-269) with the Pyrococcus furious MCM ATPase domain (PfMCM amino acids 257-361/729-966). The native PfMCM has an intein (PfMCM aa 362-728) that is removed. The expression construct for this protein has genetically removed the intein. To simplify model building and refinement, all amino acids were numbered sequentially based on the the SsoMCM sequence. Could the PfMCM portion have its amino acid numbers updated to match PDB 4R7Y? Segment 1: Current: (Q270-L374). Add 987. New: (Q1257-L1361) Segment 2: Current: (T375-D612). Add 1354. New: (T1729-D1966),N-term Saccharolobus solfataricus P2, ATPase Pyrococcus furiosus DSM 3638 The protein construct exactly matches that of PDB 4R7Y. This is a chimeric fusion of the Saccharolobus solfataricus MCM N-terminal domain (SsoMCM amino acids 1-269) with the Pyrococcus furious MCM ATPase domain (PfMCM amino acids 257-361/729-966). The native PfMCM has an intein (PfMCM aa 362-728) that is removed. The expression construct for this protein has genetically removed the intein. To simplify model building and refinement, all amino acids were numbered sequentially based on the the SsoMCM sequence. Could the PfMCM portion have its amino acid numbers updated to match PDB 4R7Y? Segment 1: Current: (Q270-L374). Add 987. New: (Q1257-L1361) Segment 2: Current: (T375-D612). Add 1354. New: (T1729-D1966),N-term Saccharolobus solfataricus P2, ATPase Pyrococcus furiosus DSM 3638 The protein construct exactly matches that of PDB 4R7Y. This is a chimeric fusion of the Saccharolobus solfataricus MCM N-terminal domain (SsoMCM amino acids 1-269) with the Pyrococcus furious MCM ATPase domain (PfMCM amino acids 257-361/729-966). The native PfMCM has an intein (PfMCM aa 362-728) that is removed. The expression construct for this protein has genetically removed the intein. To simplify model building and refinement, all amino acids were numbered sequentially based on the the SsoMCM sequence. Could the PfMCM portion have its amino acid numbers updated to match PDB 4R7Y? Segment 1: Current: (Q270-L374). Add 987. New: (Q1257-L1361) Segment 2: Current: (T375-D612). Add 1354. New: (T1729-D1966),N-term Saccharolobus solfataricus P2, ATPase Pyrococcus furiosus DSM 3638 The protein construct exactly matches that of PDB 4R7Y. This is a chimeric fusion of the Saccharolobus solfataricus MCM N-terminal domain (SsoMCM amino acids 1-269) with the Pyrococcus furious MCM ATPase domain (PfMCM amino acids 257-361/729-966). The native PfMCM has an intein (PfMCM aa 362-728) that is removed. The expression construct for this protein has genetically removed the intein. To simplify model building and refinement, all amino acids were numbered sequentially based on the the SsoMCM sequence. Could the PfMCM portion have its amino acid numbers updated to match PDB 4R7Y? Segment 1: Current: (Q270-L374). Add 987. New: (Q1257-L1361) Segment 2: Current: (T375-D612). Add 1354. New: (T1729-D1966),N-term Saccharolobus solfataricus P2, ATPase Pyrococcus furiosus DSM 3638 The protein construct exactly matches that of PDB 4R7Y. This is a chimeric fusion of the Saccharolobus solfataricus MCM N-terminal domain (SsoMCM amino acids 1-269) with the Pyrococcus furious MCM ATPase domain (PfMCM amino acids 257-361/729-966). The native PfMCM has an intein (PfMCM aa 362-728) that is removed. The expression construct for this protein has genetically removed the intein. To simplify model building and refinement, all amino acids were numbered sequentially based on the the SsoMCM sequence. Could the PfMCM portion have its amino acid numbers updated to match PDB 4R7Y? Segment 1: Current: (Q270-L374). Add 987. New: (Q1257-L1361) Segment 2: Current: (T375-D612). Add 1354. New: (T1729-D1966)</details>
                <number_of_copies>6</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="562">Escherichia coli</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>SLEIPSKQIDYRDVFIEFLTTFKGNNNQNKYIERINELVAYRKKSLIIEFSDVLSFNENLAYEIINNTKIILPILEGALY
DHILQLDPTYQRDIEKVHVRIVGIPRVIELRKIRSTDIGKLITIDGILVKVTPVKERIYKATYKHIHPDCMQEFEWPEDE
EMPEVLEMPTICPKCGKPGQFRLIPEKTKLIDWQKAVIQERPEEVPSGQLPRQLEIILEDDLVDSARPGDRVKVTGILDI
KQDSPVKRGSRAVFDIYMKVSSIEVSQKVLQELEISPEEEQIIKELAKRKDIVDAIVDSIAPAIYGYKEVKKGIALALFG
GVSRKLPDGTRLRGDIHVLLVGDPGVAKSQILRYVANLAPRAIYTSGKSSSAAGLTAAAVRDEFTGGWVLEAGALVLADG
GYALIDELDKMSDRDRSVIHEALEQQTISISKAGITATLNARTTVIAAANPKQGRFNRMKNPFEQIDLPPTLLSRFDLIF
VLIDEPDDKIDSEVARHILRVRRGESEVVAPKIPHEILRKYIAYARKNIHPVISEEAMEEIEKYYVRMRKSVKKTKGEEE
GIPPIPITARQLEALIRLSEAHARMRLSPIVTREDAREAIKLMEYTLKQIAMD</string>
                    <external_references type="UNIPROTKB">Q9UXG1</external_references>
                    <external_references type="UNIPROTKB">Q8U3I4</external_references>
                    <external_references type="UNIPROTKB">Q8U3I4</external_references>
                </sequence>
                <ec_number>3.6.4.12</ec_number>
            </protein_or_peptide>
            <dna macromolecule_id="2">
                <name>DNA (60-MER)</name>
                <natural_source database="NCBI">
                    <organism ncbi="32630">synthetic construct</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.018493824</theoretical>
                </molecular_weight>
                <number_of_copies>2</number_of_copies>
                <sequence>
                    <string>(DT)(DC)(DC)(DG)(DT)(DC)(DT)(DC)(DA)(DC)(DA)(DG)(DT)(DA)(DA)(DC)(DA)(DA)(DC)(DC)
(DC)(DT)(DC)(DC)(DG)(DC)(DC)(DT)(DG)(DA)(DT)(DC)(DA)(DG)(DG)(DC)(DG)(DG)(DA)(DG)
(DG)(DG)(DT)(DT)(DG)(DT)(DT)(DA)(DC)(DT)(DG)(DT)(DG)(DA)(DG)(DA)(DC)(DG)(DG)(DA)</string>
                </sequence>
                <classification>DNA</classification>
            </dna>
            <ligand macromolecule_id="3">
                <name>PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER</name>
                <molecular_weight>
                    <theoretical units="MDa">0.0005232469999999999</theoretical>
                </molecular_weight>
                <number_of_copies>3</number_of_copies>
                <formula>AGS</formula>
            </ligand>
            <ligand macromolecule_id="4">
                <name>MAGNESIUM ION</name>
                <molecular_weight>
                    <theoretical units="MDa">2.4305e-05</theoretical>
                </molecular_weight>
                <number_of_copies>6</number_of_copies>
                <formula>MG</formula>
            </ligand>
            <ligand macromolecule_id="5">
                <name>ZINC ION</name>
                <molecular_weight>
                    <theoretical units="MDa">6.5409e-05</theoretical>
                </molecular_weight>
                <number_of_copies>6</number_of_copies>
                <formula>ZN</formula>
            </ligand>
            <ligand macromolecule_id="6">
                <name>ADENOSINE-5'-DIPHOSPHATE</name>
                <molecular_weight>
                    <theoretical units="MDa">0.000427201</theoretical>
                </molecular_weight>
                <number_of_copies>3</number_of_copies>
                <formula>ADP</formula>
            </ligand>
            <ligand macromolecule_id="7">
                <name>water</name>
                <molecular_weight>
                    <theoretical units="MDa">1.8015e-05</theoretical>
                </molecular_weight>
                <number_of_copies>21</number_of_copies>
                <formula>HOH</formula>
            </ligand>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <buffer>
                        <ph>7.6</ph>
                    </buffer>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                    </vitrification>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>TFS KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <nominal_defocus_min units="µm">0.8</nominal_defocus_min>
                    <nominal_defocus_max units="µm">1.8</nominal_defocus_max>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>GATAN K3 (6k x 4k)</film_or_detector_model>
                            <average_electron_dose_per_image units="e/Å^2">78.22</average_electron_dose_per_image>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <ctf_correction>
                    <type>PHASE FLIPPING AND AMPLITUDE CORRECTION</type>
                </ctf_correction>
                <startup_model type_of_model="PDB ENTRY">
                    <pdb_model>
                        <pdb_id>4R7Y</pdb_id>
                    </pdb_model>
                </startup_model>
                <final_reconstruction>
                    <resolution units="Å" res_type="BY AUTHOR">2.65</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <number_images_used>235648</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                </final_angle_assignment>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="67109">
        <file>emd_49821.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>256</col>
            <row>256</row>
            <sec>256</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>256</x>
            <y>256</y>
            <z>256</z>
        </spacing>
        <cell>
            <a units="Å">276.48</a>
            <b units="Å">276.48</b>
            <c units="Å">276.48</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.6561383</minimum>
            <maximum>2.2307458</maximum>
            <average>-0.0010832374</average>
            <std>0.08264976</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">1.08</x>
            <y units="Å">1.08</y>
            <z units="Å">1.08</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.381</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-49821::::</label>
        <annotation_details>Unsharpened map</annotation_details>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <initial_model>
                    <access_code>4R7Y</access_code>
                    <chain>
                        <source_name>PDB</source_name>
                        <initial_model_type>experimental model</initial_model_type>
                    </chain>
                </initial_model>
            </modelling>
        </modelling_list>
        <additional_map_list>
            <additional_map format="CCP4" size_kbytes="67109">
                <file>emd_49821_additional_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>256</col>
                    <row>256</row>
                    <sec>256</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>256</x>
                    <y>256</y>
                    <z>256</z>
                </spacing>
                <cell>
                    <a units="Å">276.48</a>
                    <b units="Å">276.48</b>
                    <c units="Å">276.48</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-3.631608</minimum>
                    <maximum>8.542159</maximum>
                    <average>-0.0010832372</average>
                    <std>0.19783959</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.08</x>
                    <y units="Å">1.08</y>
                    <z units="Å">1.08</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-49821::::</label>
                <annotation_details>Sharpened map</annotation_details>
            </additional_map>
        </additional_map_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="67109">
                <file>emd_49821_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>256</col>
                    <row>256</row>
                    <sec>256</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>256</x>
                    <y>256</y>
                    <z>256</z>
                </spacing>
                <cell>
                    <a units="Å">276.48</a>
                    <b units="Å">276.48</b>
                    <c units="Å">276.48</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.69473165</minimum>
                    <maximum>2.4594848</maximum>
                    <average>0.0034418334</average>
                    <std>0.09958492</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.08</x>
                    <y units="Å">1.08</y>
                    <z units="Å">1.08</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-49821::::</label>
                <annotation_details>half-map A</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="67109">
                <file>emd_49821_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>256</col>
                    <row>256</row>
                    <sec>256</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>256</x>
                    <y>256</y>
                    <z>256</z>
                </spacing>
                <cell>
                    <a units="Å">276.48</a>
                    <b units="Å">276.48</b>
                    <c units="Å">276.48</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.71967864</minimum>
                    <maximum>2.5504735</maximum>
                    <average>0.0034605155</average>
                    <std>0.09956561</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.08</x>
                    <y units="Å">1.08</y>
                    <z units="Å">1.08</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-49821::::</label>
                <annotation_details>half-map B</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
