2024-12-11 REL RCSB RCSB RCSB 2024-04-15 2024-12-11 2024-12-11 2024-12-11 National Institutes of Health/National Eye Institute (NIH/NEI) R01EY030987 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R35GM124779 United States National Institutes of Health/National Eye Institute (NIH/NEI) F31EY033230 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) U24GM129547 United States alphaB-crystallin N-terminal IXI variant in a fibril state McFarland R Reichow SL small heat-shock protein fibril proteostasis cataract, CHAPERONE McFarland R Noroozi R Miller AP Reichow SL Dynamic fibrillar assembly of alpha B-crystallin induced by perturbation of the conserved NT-IXI motif resolved by cryo-EM. Nat Commun UK 15 10336 10336 2024 39609421 doi:10.1038/s41467-024-54647-7 2041-1723 9bee FULLOVERLAP Asymmetric dimer of alphaB-crystallin filament state formed by an N-terminal IXI variant Asymmetric dimer of alphaB-crystallin filament state formed by an N-terminal IXI variant 0 1 Homo sapiens 40.3 Alpha-crystallin B chain Homo sapiens 0.0099442 1 Escherichia coli LEVO SVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGP ERTIPITR P02511 Alpha-crystallin B chain Homo sapiens 0.012106734
7 residues are modeled as unknown as they are identifiable in the EM volume with 1 being able to be assigned an identity with intermediate confidence. We cannot clearly identify which protomer the bound peptide corresponds to though it is believed to play a key role in the oligomerization. We have opted to include the peptide as part of Chain A with numbering based on our best approximation from related protein species and mass spec data published by others. The residues are labelled as unknown to reflect our low confidence of the identity of the peptide.
1 Escherichia coli LEVO (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)TGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEER QDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITR helical filament 0.5 7.4 20.0 C8H18N2O4S HEPES 100.0 NaCl Sodium Chloride 1.0 C10H16N2O8 EDTA Quantifoil COPPER CARBON HOLEY GLOW DISCHARGE AIR ETHANE 100 277 FEI VITROBOT MARK IV TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 2.3 0.5 2.0 FEI TITAN KRIOS AUTOGRID HOLDER NITROGEN GATAN K3 (6k x 4k) 1 10654 50.0 1 39.9 31.6 D2 3.4 FSC 0.143 CUT-OFF 1393386 2201394 cryoSPARC NOT APPLICABLE cryoSPARC emd_44477.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 288 288 288 0 0 0 288 288 288 226.944 226.944 226.944 90.0 90.0 90.0 X Y Z -0.2349636 0.34744844 0.0012115794 0.010489999 0.788 0.788 0.788 0.054 AUTHOR 2WJ7 PDB experimental model FLEXIBLE FIT REAL emd_44477_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 288 288 288 0 0 0 288 288 288 226.944 226.944 226.944 90.0 90.0 90.0 X Y Z -0.014114106 0.47208926 0.004650494 0.020640576 0.788 0.788 0.788 AUTHOR emd_44477_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 288 288 288 0 0 0 288 288 288 226.944 226.944 226.944 90.0 90.0 90.0 X Y Z -0.29989016 0.4415753 0.00071371737 0.03380257 0.788 0.788 0.788 AUTHOR emd_44477_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 288 288 288 0 0 0 288 288 288 226.944 226.944 226.944 90.0 90.0 90.0 X Y Z -0.29525417 0.42422363 0.0007590418 0.027481562 0.788 0.788 0.788 AUTHOR