2025-01-22 REL RCSB RCSB RCSB 2024-04-15 2025-01-22 2025-01-22 2025-01-22 National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) GM077234 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) GM062750 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) GM120923 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) GM128577 United States Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp Yang H Stachowski K Foster M Hexamer of dTRAP apo, RNA BINDING PROTEIN Li W Yang H Stachowski K Norris AS Lichtenthal K Kelly S Gollnick P Wysocki VH Foster MP Structural basis of nearest-neighbor cooperativity in the ring-shaped gene regulatory protein TRAP from protein engineering and cryo-EM. Proc.Natl.Acad.Sci.USA US 122 e2409030121 e2409030121 2025 39793047 doi:10.1073/pnas.2409030121 1091-6490 0040 PNASA6 9be7 FULLOVERLAP Hexamer dTRAP protein complex without Trp Hexamer dTRAP protein complex without Trp 0 1 Halalkalibacterium halodurans Transcription attenuation protein MtrB Halalkalibacterium halodurans 0.018418471000000002 6 Escherichia coli BL21(DE3) LEVO MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGG SGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEK DEENLYFQ Q9KCC6 singleParticle particle 6 8.0 20.0 C8H18N2O4S HEPES 200.0 NaCl Sodium Chloride
20 mM HEPES, 200 mM NaCl, pH 8
 Quantifoil R1.2/1.3 GOLD 300 GLOW DISCHARGE
20 mA, 30 sec hold, 1 min glow discharge using a PELCO easiGlow Discharge System
 ETHANE 100 277.15 FEI VITROBOT MARK IV
lotted with a blot force of 1 for 4 seconds at 277.15K and 100% relative humidity before being plunged frozen into liquid ethane.
An aliquot of 10 mg/mL of apo dTRAP was diluted with cryo-EM buffer (20 mM HEPES, 200 mM NaCl, pH 8) supplemented with a 0.6% stock of Triton X-100 to obtain a final sample of 6 mg/mL protein and 0.05% Triton X-100.
 TFS KRIOS OTHER BRIGHT FIELD FIELD EMISSION GUN 300 0.5 2.0 GATAN K3 BIOCONTINUUM (6k x 4k) 60.0 1 4.24 FSC 0.143 CUT-OFF 91038 ANGULAR RECONSTITUTION ANGULAR RECONSTITUTION emd_44472.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 219.648 219.648 219.648 90.0 90.0 90.0 X Y Z -0.3665253 0.5110273 0.0007831318 0.016348941 0.858 0.858 0.858 0.135 AUTHOR emd_44472_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 219.648 219.648 219.648 90.0 90.0 90.0 X Y Z -0.3366043 0.3514234 0.0007403734 0.042310767 0.858 0.858 0.858 AUTHOR emd_44472_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 219.648 219.648 219.648 90.0 90.0 90.0 X Y Z -0.34117317 0.34341606 0.00074717245 0.042299453 0.858 0.858 0.858 AUTHOR