2025-05-28 REL RCSB INITIAL_RELEASE REPOSITORY STRUCTURE_SUMMARY citation citation_author em_admin pdbx_entry_details _citation.country _citation.journal_abbrev _citation.journal_id_CSD _citation.journal_id_ISSN _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year _citation_author.identifier_ORCID _citation_author.name _em_admin.last_update _pdbx_entry_details.has_protein_modification DATABASE_REFERENCES citation em_admin _citation.journal_volume _citation.page_first _citation.page_last _em_admin.last_update RCSB RCSB 2023-12-18 2024-06-05 2024-06-05 2025-05-28 National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) GM142196 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) AG067594 United States (Biarylamine-FT2-WT)1(C10A)3-human transthyretin in the compressed conformation Basanta B Nugroho K Yan N Kline GM Tsai FJ Wu M Kelly JW Lander GC Amyloidosis, TRANSPORT PROTEIN Basanta B Nugroho K Yan NL Kline GM Powers ET Tsai FJ Wu M Hansel-Harris A Chen JS Forli S Kelly JW Lander GC The conformational landscape of human transthyretin revealed by cryo-EM. Nat.Struct.Mol.Biol. US 32 876 883 2025 39843982 doi:10.1038/s41594-024-01472-7 1545-9985 8ve5 FULLOVERLAP Transthyretin Transthyretin 0 1 Homo sapiens 0.05782 Transthyretin Homo sapiens 0.015902508 4 Escherichia coli LEVO MDYKDDDDKDYKDDDDKGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEE FVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE P02766 2-[(3,5-DICHLORO-4-TRIOXIDANYLPHENYL)AMINO]BENZOIC ACID 0.00033012 1 P2C singleParticle particle 0.9 7.6 100.0 KCl Potassium Chloride 8.66 K2HPO4 Potassium Phosphate 1.34 KH2PO4 Potassium Phosphate 1.0 C10H16N2O8 EDTA UltrAuFoil R1.2/1.3 GOLD 300 GRAPHENE CONTINUOUS OTHER
The graphene grids were treated with UV/ozone using the UVOCS T10xT10 system. A 10-minute warmup run was performed immediately prior to inserting and treating grids for 4 minutes.
 ETHANE 90 279 HOMEMADE PLUNGER
3 uL of sample were applied onto the graphene side of the grid after it was mounted on the plunger (always at the same height), and immediately blotted for 3 seconds by holding a 1 x 6 cm piece of Whatman 1 filter paper parallel to the grid, in full contact. Timing was kept with the help of a metronome. The blotting countdown was started after the blotted liquid spot on the filter paper stopped spreading and the grid was plunged in liquid ethane at the same time the blotting paper was pulled back, in a single motion..
FEI TALOS ARCTICA FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 200 50.0 2.7 0.5 0.5 1.5 1.5 73000.0 88968.0 FEI TITAN KRIOS AUTOGRID HOLDER NITROGEN 78.0 85.0 GATAN K2 SUMMIT (4k x 4k) COUNTING 3838 3710 1-50 1 7939 6.8 50.0 1 CTFFIND 4 PHASE FLIPPING AND AMPLITUDE CORRECTION 1TTR C1 3.4 FSC 0.143 CUT-OFF RELION 3.1 168443 MAXIMUM LIKELIHOOD MAXIMUM LIKELIHOOD emd_43165.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 143.872 143.872 143.872 90.0 90.0 90.0 X Y Z -0.04389396 0.056709565 0.000057254645 0.0017672667 0.562 0.562 0.562 0.00808 AUTHOR Single bound TTR compressed map emd_43165_msk_1.map emd_43165_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 143.872 143.872 143.872 90.0 90.0 90.0 X Y Z -0.027762704 0.039953668 0.00001827251 0.0029318596 0.562 0.562 0.562 AUTHOR Single bound TTR compressed half map 1 emd_43165_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 143.872 143.872 143.872 90.0 90.0 90.0 X Y Z -0.02803268 0.047444448 0.000019658833 0.002934872 0.562 0.562 0.562 AUTHOR Single bound TTR compressed half map 2