2025-07-09 REL PDBe INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY EXPERIMENTAL_SUMMARY em_admin em_software _em_admin.last_update _em_software.name DERIVED_CALCULATIONS chem_comp_atom chem_comp_bond database_2 struct_conn _database_2.pdbx_DOI _database_2.pdbx_database_accession _struct_conn.pdbx_dist_value _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_atom_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_atom_id _struct_conn.ptnr2_label_comp_id STRUCTURE_SUMMARY em_admin em_software pdbx_entry_details _em_admin.last_update _em_software.name PDBe PDBe 2017-12-14 2018-01-17 2018-04-11 2025-07-09 Wellcome Trust 202754/Z/16/Z United Kingdom AlfA from B. subtilis plasmid pLS32 filament structure at 3.4 A Szewczak-Harris A Lowe J plasmid segregation, bacterial cytoskeleton, cytomotive filament, VIRAL PROTEIN Szewczak-Harris A Lowe J Cryo-EM reconstruction of AlfA fromBacillus subtilisreveals the structure of a simplified actin-like filament at 3.4- angstrom resolution. Proc. Natl. Acad. Sci. U.S.A. US 115 3458 3463 2018 29440489 doi:10.1073/pnas.1716424115 1091-6490 0040 PNASA6 6f95 FULLOVERLAP AlfA filament AlfA filament 0 1 Bacillus subtilis AlfA Bacillus subtilis 0.031200280999999996 5 Escherichia coli LEVO GSHMTLTTVIDIGNFSTKYAYKDAAQIKVGSFPSILHSYKPLEDYEGMERVEYNGLDYYVGETVKNFYFGREEQMYFGNT RKGHMEGQIRLVYALYTIFKETGAAEFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFKFTVHNIVMAAEGLGALN FSDSLNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAKTCSNIDYDYPIVCTGGKAEEMKECLEN VGYSTVSSAELGEDKPSYYVNSVGLLLKYGRKFEEMFA O52947 MAGNESIUM ION 2.4305e-05 5 MG ADENOSINE-5'-DIPHOSPHATE 0.000427201 5 ADP helical filament 8.0
20 mM Tris-HCl, 100 mM KCl, 2 mM TCEP, 1mM NaN3, pH 8.0, 5 mM ATP and 10 mM MgCl2 added to
 Quantifoil R1.2/1.3 COPPER 300 ETHANE FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 FEI FALCON III (4k x 4k) COUNTING 368 33.0 1 24.9219 156.521 C1 3.44 FSC 0.143 CUT-OFF 78787 PHASE FLIPPING AND AMPLITUDE CORRECTION 1MWM NOT APPLICABLE emd_4196.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 350 350 350 0 0 0 350 350 350 374.50003 374.50003 374.50003 90.0 90.0 90.0 X Y Z -0.19875619 0.3822973 -0.000059827093 0.009580199 1.07 1.07 1.07 0.07 AUTHOR AB INITIO MODEL