<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_9_3/emdb.xsd" version="3.0.9.3" emdb_id="EMD-3860">
    <admin>
        <current_status>
            <date>2024-10-09</date>
            <code>REL</code>
            <processing_site>PDBe</processing_site>
        </current_status>
        <sites>
            <deposition>PDBe</deposition>
            <last_processing>PDBe</last_processing>
        </sites>
        <key_dates>
            <deposition>2017-09-08</deposition>
            <header_release>2017-09-20</header_release>
            <map_release>2017-12-20</map_release>
            <update>2024-10-09</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>University of Zurich</funding_body>
                <code>FK-16-036</code>
                <country>Switzerland</country>
            </grant_reference>
            <grant_reference>
                <funding_body>European Research Council</funding_body>
                <code>339116AnoBest</code>
                <country>Switzerland</country>
            </grant_reference>
        </grant_support>
        <title>Cryo-EM map of calcium-bound mTMEM16A chloride channel at 3.75 A resolution</title>
        <authors_list>
            <author>Paulino C</author>
            <author>Kalienkova V</author>
        </authors_list>
        <keywords>TMEM16 family, ion channel, membrane protein, cryo-EM</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author order="1">Paulino C</author>
                    <author order="2">Kalienkova V</author>
                    <author order="3">Lam AKM</author>
                    <author order="4">Neldner Y</author>
                    <author order="5">Dutzler R</author>
                    <title>Activation mechanism of the calcium-activated chloride channel TMEM16A revealed by cryo-EM.</title>
                    <journal_abbreviation>Nature</journal_abbreviation>
                    <country>UK</country>
                    <volume>552</volume>
                    <first_page>421</first_page>
                    <last_page>425</last_page>
                    <year>2017</year>
                    <external_references type="PUBMED">29236691</external_references>
                    <external_references type="DOI">doi:10.1038/nature24652</external_references>
                    <external_references type="ISSN">1476-4687</external_references>
                    <external_references type="CSD">0006</external_references>
                    <external_references type="ASTM">NATUAS</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <emdb_list>
            <emdb_reference>
                <emdb_id>EMD-3861</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>structure of the calcium-free mTMEM16A chloride channel at 4.06 A</details>
            </emdb_reference>
        </emdb_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>5oyb</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
    </crossreferences>
    <sample>
        <name>mTMEM16A with calcium ions bound</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>mTMEM16A with calcium ions bound</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <details>calcium-activated chloride channel</details>
                <natural_source database="NCBI">
                    <organism ncbi="10090">Mus musculus</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.110916</theoretical>
                </molecular_weight>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>Anoctamin-1</name>
                <natural_source database="NCBI">
                    <organism ncbi="10090">Mus musculus</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.111058992</theoretical>
                </molecular_weight>
                <number_of_copies>2</number_of_copies>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>MRVPEKYSTLPAEDRSVHIVNICAIEDLGYLPSEGTLLNSLSVDPDAECKYGLYFRDGKRKVDYILVYHHKRASGSRTLA
RRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHA
PWHVLCREAEFLKLKMPTKKVYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRLSYPFSREKQHLFDLTDRDSF
FDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYSAAYPLHDGDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLV
RKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPLCDKTCSYWKMSSACATARA
SHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLRKESRNKETDKVK
LTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCI
ARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSI
IMLGKQLIQNNLFEIGIPKMKKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLEPFAGLTPEYMEMIIQFGFVTLFVASF
PLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGT
MHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQNLVMFMSD
FVDWVIPDIPKDISQQIHKEKVLMVELFMREEQGKQQLLDTWMEKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL</string>
                    <external_references type="UNIPROTKB">Q8BHY3</external_references>
                </sequence>
            </protein_or_peptide>
            <ligand macromolecule_id="2">
                <name>CALCIUM ION</name>
                <molecular_weight>
                    <theoretical units="MDa">4.0078e-05</theoretical>
                </molecular_weight>
                <number_of_copies>4</number_of_copies>
                <formula>CA</formula>
            </ligand>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <concentration units="mg/mL">3.5</concentration>
                    <buffer>
                        <ph>7.5</ph>
                        <component>
                            <concentration units="mM">20.0</concentration>
                            <name>Hepes</name>
                        </component>
                        <details>20 mM Hepes
150 mM NaCl
0.5 mM CaCl2
&lt;0.12% digitonin</details>
                    </buffer>
                    <grid>
                        <model>Quantifoil R1.2/1.3</model>
                        <material>GOLD</material>
                        <mesh>200</mesh>
                        <support_film film_type_id="1">
                            <film_material>CARBON</film_material>
                            <film_topology>HOLEY</film_topology>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">30</time>
                        </pretreatment>
                    </grid>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                        <chamber_humidity units="percentage">100</chamber_humidity>
                        <chamber_temperature units="K">288</chamber_temperature>
                        <instrument>FEI VITROBOT MARK IV</instrument>
                        <details>2 ul sample volume
2-4 sec blotting time. </details>
                    </vitrification>
                    <details>full-length (wild-type isoform ac)  deglycosylated mTMEM16A in presence of 0.5mM CaCl2</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>FEI TITAN KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <c2_aperture_diameter units="µm">100.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.7</nominal_cs>
                    <nominal_defocus_min units="µm">0.5</nominal_defocus_min>
                    <calibrated_defocus_min units="µm">0.5</calibrated_defocus_min>
                    <nominal_defocus_max units="µm">3.0</nominal_defocus_max>
                    <calibrated_defocus_max units="µm">3.0</calibrated_defocus_max>
                    <nominal_magnification>46511.0</nominal_magnification>
                    <calibrated_magnification>46511.0</calibrated_magnification>
                    <specimen_holder_model>FEI TITAN KRIOS AUTOGRID HOLDER</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <temperature>
                        <temperature_min units="K">80.0</temperature_min>
                        <temperature_max units="K">100.0</temperature_max>
                    </temperature>
                    <alignment_procedure>
                        <coma_free/>
                    </alignment_procedure>
                    <specialist_optics>
                        <energy_filter>
                            <name>In-column Omega Filter</name>
                            <lower_energy_threshold units="eV">-10</lower_energy_threshold>
                            <upper_energy_threshold units="eV">+10</upper_energy_threshold>
                        </energy_filter>
                    </specialist_optics>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>GATAN K2 SUMMIT (4k x 4k)</film_or_detector_model>
                            <detector_mode>SUPER-RESOLUTION</detector_mode>
                            <digitization_details>
                                <dimensions>
                                    <width units="pixel">7420</width>
                                    <height units="pixel">7676</height>
                                </dimensions>
                                <frames_per_image>1-80</frames_per_image>
                            </digitization_details>
                            <number_grids_imaged>3</number_grids_imaged>
                            <number_real_images>4343</number_real_images>
                            <average_exposure_time units="s">10.0</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">80.0</average_electron_dose_per_image>
                            <details>Data were collected in an automated fashion using SerialEM47 on a K2 Summit detector (Gatan). For the dataset in presence of calcium ions, cryo-EM images were collected at a pixel size of 0.5375A in super-resolution mode, a defocus range of -0.5 to -3.0 um, an exposure time of 10 sec and a sub-frame exposure time of 125 ms (80 frames) with an approximate electron dose of 1 e-/A2/frame. An extensive effort was made for this dataset to screen different areas within the grid and only regions that provided an estimated resolution of the CTF fit of better than 4A were selected for data collection. The total accumulated dose on the specimen level was approximately 80 e-/A2.</details>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <details>Fourier cropping (final pixel size 1.075 A), motion correction and dose-weighting of frames were performed by MotionCor2</details>
                <particle_selection>
                    <number_selected>629679</number_selected>
                    <details>For the dataset collected in presence of calcium ions a total of 4,342 dose-fractionated super-resolution images were recorded, 2 x 2 down-sampled by Fourier cropping (final pixel size 1.075A) and subjected to motion correction and dose-weighting of frames by MotionCor248. The contrast transfer function (CTF) parameters were estimated on the movie frames by ctffind4.149. Images showing a strong drift, higher defocus than -3.0 um or a bad CTF estimation were discarded, resulting in 2,997 images used for further analysis with the software package RELION2.1b150. Particles were picked automatically using 2D class averages from the previously obtained TMEM16A cryo-EM map as reference26 providing an initial set of 629,679 particles. After extraction with a box size of 300 pixels, false positives were eliminated manually or through a first round of 2D classification, resulting in 368,162 particles that were further subjected to several rounds of 2D classification to remove particles belonging to low-abundance classes. The remaining 252,577 particles were sorted during 3D Classification, a C2 symmetry was imposed and the low-resolution TMEM16A cryo-EM map (EMD-3658) was used as initial model. The best class, comprising 147,368 particles from a total of 2012 images, was subjected to auto-refinement and particle polishing in RELION, with a running average window of 5, a standard deviation of 1 pixel on translations and 200 pixels on particle distance. The final polished and auto-refined map used for model building had a resolution of 4.6A before masking and 3.75A after masking and was sharpened using an isotropic b-factor of -1063A2</details>
                </particle_selection>
                <startup_model type_of_model="PDB ENTRY">
                    <pdb_model>
                        <pdb_id>5NL2</pdb_id>
                    </pdb_model>
                </startup_model>
                <final_reconstruction>
                    <applied_symmetry>
                        <point_group>C2</point_group>
                    </applied_symmetry>
                    <resolution units="Å" res_type="BY AUTHOR">3.75</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>2.1b1</version>
                        </software>
                    </software_list>
                    <number_images_used>147368</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>ANGULAR RECONSTITUTION</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>21b1</version>
                        </software>
                    </software_list>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>ANGULAR RECONSTITUTION</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>2.1b1</version>
                        </software>
                    </software_list>
                </final_angle_assignment>
                <final_three_d_classification>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>2.1b1</version>
                        </software>
                    </software_list>
                </final_three_d_classification>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="108001">
        <file>emd_3860.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>300</col>
            <row>300</row>
            <sec>300</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>300</x>
            <y>300</y>
            <z>300</z>
        </spacing>
        <cell>
            <a units="Å">322.5</a>
            <b units="Å">322.5</b>
            <c units="Å">322.5</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.04136806</minimum>
            <maximum>0.081163116</maximum>
            <average>0.000087103224</average>
            <std>0.0029635872</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">1.075</x>
            <y units="Å">1.075</y>
            <z units="Å">1.075</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.024</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-3860::::</label>
        <annotation_details>None</annotation_details>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <refinement_protocol>RIGID BODY FIT</refinement_protocol>
            </modelling>
        </modelling_list>
        <segmentation_list>
            <segmentation>
                <file>emd_3860_msk_1.map</file>
            </segmentation>
        </segmentation_list>
        <additional_map_list>
            <additional_map format="CCP4" size_kbytes="108001">
                <file>emd_3860_additional_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>300</col>
                    <row>300</row>
                    <sec>300</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>300</x>
                    <y>300</y>
                    <z>300</z>
                </spacing>
                <cell>
                    <a units="Å">322.5</a>
                    <b units="Å">322.5</b>
                    <c units="Å">322.5</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.07279356</minimum>
                    <maximum>0.12662388</maximum>
                    <average>0.00008710323</average>
                    <std>0.004395553</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.075</x>
                    <y units="Å">1.075</y>
                    <z units="Å">1.075</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::D_1200006568::::</label>
                <annotation_details>None</annotation_details>
            </additional_map>
        </additional_map_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="108001">
                <file>emd_3860_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>300</col>
                    <row>300</row>
                    <sec>300</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>300</x>
                    <y>300</y>
                    <z>300</z>
                </spacing>
                <cell>
                    <a units="Å">322.5</a>
                    <b units="Å">322.5</b>
                    <c units="Å">322.5</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.0087958705</minimum>
                    <maximum>0.023413412</maximum>
                    <average>0.000010159953</average>
                    <std>0.001291705</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.075</x>
                    <y units="Å">1.075</y>
                    <z units="Å">1.075</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::D_1200006568::::</label>
                <annotation_details>cryo-EM half map 2 of the ion channel TMEM16A from mouse in presence of calcium ions</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="108001">
                <file>emd_3860_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>300</col>
                    <row>300</row>
                    <sec>300</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>300</x>
                    <y>300</y>
                    <z>300</z>
                </spacing>
                <cell>
                    <a units="Å">322.5</a>
                    <b units="Å">322.5</b>
                    <c units="Å">322.5</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.0093410695</minimum>
                    <maximum>0.024025878</maximum>
                    <average>0.00008096233</average>
                    <std>0.001292658</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.075</x>
                    <y units="Å">1.075</y>
                    <z units="Å">1.075</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::D_1200006568::::</label>
                <annotation_details>cryo-EM half map 1 of the ion channel TMEM16A from mouse in presence of calcium ions</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
