<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_11_0/emdb.xsd" version="3.0.11.0" emdb_id="EMD-36441">
    <admin>
        <current_status>
            <date>2025-12-24</date>
            <code>REL</code>
            <processing_site>PDBj</processing_site>
        </current_status>
        <sites>
            <deposition>PDBj</deposition>
            <last_processing>PDBj</last_processing>
        </sites>
        <key_dates>
            <deposition>2023-06-06</deposition>
            <header_release>2024-06-12</header_release>
            <map_release>2024-06-12</map_release>
            <update>2025-12-24</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>National Research Foundation (NRF, Singapore)</funding_body>
                <code>NRF-NRFI2016-01</code>
                <country>Singapore</country>
            </grant_reference>
        </grant_support>
        <title>Cryo-EM structure of dengue virus serotype 3 strain CH53489 spherical particle in complex with human antibody DENV-290 Fab at 37 deg C</title>
        <authors_list>
            <author ORCID="0000-0002-9990-3335">Fibriansah G</author>
            <author ORCID="0000-0002-1668-8976">Ng TS</author>
            <author ORCID="0000-0002-4046-7380">Tan AWK</author>
            <author ORCID="0000-0003-3810-5302">Shi J</author>
            <author ORCID="0000-0003-4631-8041">Lok SM</author>
        </authors_list>
        <keywords>dengue virus, human antibody, dengue-antibody structure, virus</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author ORCID="0000-0002-9990-3335" order="1">Fibriansah G</author>
                    <author ORCID="0000-0002-1668-8976" order="2">Ng TS</author>
                    <author ORCID="0000-0001-8117-3613" order="3">Lim XN</author>
                    <author order="4">Shebanova A</author>
                    <author ORCID="0000-0003-2413-3863" order="5">Ng LC</author>
                    <author order="6">Tan SL</author>
                    <author ORCID="0000-0002-4046-7380" order="7">Tan AWK</author>
                    <author order="8">Shi J</author>
                    <author ORCID="0000-0002-0049-1079" order="9">Crowe Jr JE</author>
                    <author ORCID="0000-0003-4631-8041" order="10">Lok SM</author>
                    <title>Ultrapotent human antibodies lock E protein dimers central region of diverse DENV3 morphological variants.</title>
                    <journal_abbreviation>Nat Commun</journal_abbreviation>
                    <country>UK</country>
                    <volume>16</volume>
                    <first_page>9182</first_page>
                    <last_page>9182</last_page>
                    <year>2025</year>
                    <external_references type="PUBMED">41102151</external_references>
                    <external_references type="DOI">doi:10.1038/s41467-025-64210-7</external_references>
                    <external_references type="ISSN">2041-1723</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <emdb_list>
            <emdb_reference>
                <emdb_id>EMD-36432</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C (subparticle LLR-LRR)</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36433</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C (subparticle LLR-LRR)</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36434</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of the small tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36435</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of the big tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36439</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36440</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
        </emdb_list>
        <other_db_list>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36432</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C (subparticle LLR-LRR)</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36433</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C (subparticle LLR-LRR)</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36434</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of the small tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36435</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of the big tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36439</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36440</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36441</accession_id>
                <content_type>associated EM volume</content_type>
            </db_reference>
        </other_db_list>
    </crossreferences>
    <sample>
        <name>Dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>4</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="2">
                <name>Dengue virus serotype 3 strain CH53489</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="11069">Dengue virus type 3</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="3">
                <name>Human antibody DENV-290 Fab (heavy and light chain)</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>4</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>Envelope protein</name>
                <natural_source database="NCBI">
                    <organism ncbi="7160">Aedes albopictus</organism>
                </natural_source>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>mrcvgvgnrd fveglsgatw
vdvvlehggc vttmaknkpt ldielqktea tqlatlrklc iegkitnitt dsrcptqgea
vlpeeqdqny vckhtyvdrg wgngcglfgk gslvtcakfq clepiegkvv qyenlkytvi
itvhtgdqhq vgnetqgvta eitpqastte ailpeygtlg lecsprtgld fnemilltmk
nkawmvhrqw ffdlplpwas gattetptwn rkellvtfkn ahakkqevvv lgsqegamht
altgateiqn sggtsifagh lkcrlkmdkl elkgmsyamc tntfvlkkev setqhgtili
kveykgedap ckipfstedg qgkahngrli tanpvvtkke epvnieaepp fgesnivigi
gdnalkinwy kkgssigkmf eatargarrm ailgdtawdf gsvggvlnsl gkmvhqifgs
aytalfsgvs wvmkigigvl ltwiglnskn tsmsfsciai giitlylgav vqa</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="2">
                <name>Membrane protein</name>
                <natural_source database="NCBI">
                    <organism ncbi="7160">Aedes albopictus</organism>
                </natural_source>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>svala phvgmgldtr tqtwmsaega wrqvekvetw
alrhpgftil alflahyigt sltqkvvifi llmlvtpsmt</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="3">
                <name>Human antibody DENV-290 heavy chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QVELVESGGDVVQPGKSLRLSCAASGFTFTNYAMHWLRQAPGKGLEWVAVISSDVNDKYYADSVKGRFTISRDNSKNTLYLQMNSLTPEDTAVYYCAREQAVGTNPWAFDYWGQGTLVTVSS</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="4">
                <name>Human antibody DENV-290 light chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>HIVMTQSPLSLSVTPGQPASISCKSSQISSWGSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVSDRFSGSGSGTDFTLKISRVQAEDVGLYYCMQGLHLPLTFGQGTRLEIK</string>
                </sequence>
            </protein_or_peptide>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <buffer>
                        <ph>8.0</ph>
                        <details>NTE buffer (12 mM Tris-HCl pH 8.0, 120 mM NaCl and 1 mM EDTA)</details>
                    </buffer>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                    </vitrification>
                    <details>The purified virus was mixed with DENV-290 Fab at a molar ratio of 1.5 Fab for every E-protein and then the mixture was incubated at 4 deg C for 30 min. The complex was further incubated at 37 deg C for 30 min, and then incubated at 4 deg C for another 2 h</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>FEI TITAN KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <nominal_defocus_min units="µm">0.5</nominal_defocus_min>
                    <nominal_defocus_max units="µm">5.0</nominal_defocus_max>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>FEI FALCON II (4k x 4k)</film_or_detector_model>
                            <average_electron_dose_per_image units="e/Å^2">18.0</average_electron_dose_per_image>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <ctf_correction>
                    <type>PHASE FLIPPING AND AMPLITUDE CORRECTION</type>
                </ctf_correction>
                <startup_model type_of_model="EMDB MAP">
                    <emdb_id>EMD-5933</emdb_id>
                </startup_model>
                <final_reconstruction>
                    <applied_symmetry>
                        <point_group>I</point_group>
                    </applied_symmetry>
                    <resolution units="Å" res_type="BY AUTHOR">5.6</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>RELION</name>
                        </software>
                    </software_list>
                    <number_images_used>23584</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                        </software>
                    </software_list>
                </final_angle_assignment>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="536871">
        <file>emd_36441.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>512</col>
            <row>512</row>
            <sec>512</sec>
        </dimensions>
        <origin>
            <col>-256</col>
            <row>-256</row>
            <sec>-256</sec>
        </origin>
        <spacing>
            <x>512</x>
            <y>512</y>
            <z>512</z>
        </spacing>
        <cell>
            <a units="Å">875.52</a>
            <b units="Å">875.52</b>
            <c units="Å">875.52</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-5.6456323</minimum>
            <maximum>13.366391</maximum>
            <average>-0.000000009142066</average>
            <std>1.0</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">1.71</x>
            <y units="Å">1.71</y>
            <z units="Å">1.71</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>2.0</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-36441::::</label>
        <annotation_details>postprocessed map</annotation_details>
    </map>
    <interpretation>
        <segmentation_list>
            <segmentation>
                <file>emd_36441_msk_1.map</file>
            </segmentation>
        </segmentation_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="536871">
                <file>emd_36441_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>512</col>
                    <row>512</row>
                    <sec>512</sec>
                </dimensions>
                <origin>
                    <col>-256</col>
                    <row>-256</row>
                    <sec>-256</sec>
                </origin>
                <spacing>
                    <x>512</x>
                    <y>512</y>
                    <z>512</z>
                </spacing>
                <cell>
                    <a units="Å">875.52</a>
                    <b units="Å">875.52</b>
                    <c units="Å">875.52</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-2.319241</minimum>
                    <maximum>7.7956686</maximum>
                    <average>-0.000000008986083</average>
                    <std>0.99999994</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.71</x>
                    <y units="Å">1.71</y>
                    <z units="Å">1.71</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-36441::::</label>
                <annotation_details>half map 2</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="536871">
                <file>emd_36441_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>512</col>
                    <row>512</row>
                    <sec>512</sec>
                </dimensions>
                <origin>
                    <col>-256</col>
                    <row>-256</row>
                    <sec>-256</sec>
                </origin>
                <spacing>
                    <x>512</x>
                    <y>512</y>
                    <z>512</z>
                </spacing>
                <cell>
                    <a units="Å">875.52</a>
                    <b units="Å">875.52</b>
                    <c units="Å">875.52</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-2.3565938</minimum>
                    <maximum>7.6537824</maximum>
                    <average>-0.000000005961815</average>
                    <std>1.0</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.71</x>
                    <y units="Å">1.71</y>
                    <z units="Å">1.71</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-36441::::</label>
                <annotation_details>half map 1</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
