2025-12-24 REL PDBj PDBj PDBj 2023-06-06 2024-06-12 2024-06-12 2025-12-24 National Research Foundation (NRF, Singapore) NRF-NRFI2016-01 Singapore Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C Fibriansah G Ng TS Tan AWK Shi J Lok SM dengue virus, human antibody, dengue-antibody structure, virus Fibriansah G Ng TS Lim XN Shebanova A Ng LC Tan SL Tan AWK Shi J Crowe Jr JE Lok SM Ultrapotent human antibodies lock E protein dimers central region of diverse DENV3 morphological variants. Nat Commun UK 16 9182 9182 2025 41102151 doi:10.1038/s41467-025-64210-7 2041-1723 EMD-36432 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C (subparticle LLR-LRR)
 EMD-36433 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C (subparticle LLR-LRR)
 EMD-36434 other EM volume
Cryo-EM structure of the small tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C
 EMD-36435 other EM volume
Cryo-EM structure of the big tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C
 EMD-36439 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C
 EMD-36441 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain CH53489 spherical particle in complex with human antibody DENV-290 Fab at 37 deg C
 EMDB EMD-36432 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C (subparticle LLR-LRR)
 EMDB EMD-36433 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C (subparticle LLR-LRR)
 EMDB EMD-36434 other EM volume
Cryo-EM structure of the small tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C
 EMDB EMD-36435 other EM volume
Cryo-EM structure of the big tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C
 EMDB EMD-36439 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C
 EMDB EMD-36441 other EM volume
Cryo-EM structure of dengue virus serotype 3 strain CH53489 spherical particle in complex with human antibody DENV-290 Fab at 37 deg C
 EMDB EMD-36440 associated EM volume Dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C Dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C 0 1 2 3 4 Dengue virus serotype 3 strain 863DK 1 1 2 Dengue virus type 3 Human antibody DENV-290 Fab (heavy and light chain) 1 3 4 Homo sapiens Envelope protein Dengue virus type 3 LEVO mrcvgvgnrd fveglsgatw vdvvlehggc vttmaknkpt ldielqktea tqlatlrklc iegkitnitt dsrcptqgea vlpeeqdqny vckhtyvdrg wgngcglfgk gslvtcakfq clepiegkvv qyenlkytvi itvhtgdqhq vgnetqgvta eitpqastte ailpeygtlg lecsprtgld fnemilltmk nkawmvhrqw ffdlplpwas gattetptwn rkellvtfkn ahakkqevvv lgsqegamht altgateiqn sggtsifagh lkcrlkmdkl elkgmsyamc tntfvlkkev setqhgtili kveykgedap ckipfstedg qgkahngrli tanpvvtkke epvnieaepp fgesnivigi gdnalkinwy kkgssigkmf eatargarrm ailgdtawdf gsvggvlnsl gkmvhqifgs aytalfsgvs wvmkigigvl ltwiglnskn tsmsfsciai giitlylgav vqa Membrane protein Dengue virus type 3 LEVO svala phvgmgldtr tqtwmsaega wrqvekvetw alrhpgftil alflahyigt sltqkvvifi llmlvtpsmt Human antibody DENV-290 heavy chain Homo sapiens Homo sapiens LEVO QVELVESGGDVVQPGKSLRLSCAASGFTFTNYAMHWLRQAPGKGLEWVAVISSDVNDKYYADSVKGRFTISRDNSKNTLYLQMNSLTPEDTAVYYCAREQAVGTNPWAFDYWGQGTLVTVSS Human antibody DENV-290 light chain Homo sapiens Homo sapiens LEVO HIVMTQSPLSLSVTPGQPASISCKSSQISSWGSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVSDRFSGSGSGTDFTLKISRVQAEDVGLYYCMQGLHLPLTFGQGTRLEIK singleParticle particle 8.0
NTE buffer (12 mM Tris-HCl pH 8.0, 120 mM NaCl and 1 mM EDTA)
 ETHANE
The purified virus was mixed with DENV-290 Fab at a molar ratio of 1.5 Fab for every E-protein and then the mixture was incubated at 4 deg C for 30 min. The complex was further incubated at 37 deg C for 30 min, and then incubated at 4 deg C for another 2 h
 FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 0.5 5.0 FEI FALCON II (4k x 4k) 18.0 1 PHASE FLIPPING AND AMPLITUDE CORRECTION EMD-5933 I 3.7 FSC 0.143 CUT-OFF RELION 92740 MAXIMUM LIKELIHOOD MAXIMUM LIKELIHOOD RELION emd_36440.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 512 512 512 -256 -256 -256 512 512 512 875.52 875.52 875.52 90.0 90.0 90.0 X Y Z -5.420362 16.970690000000001 -0.000000004774026 1.0 1.71 1.71 1.71 2.2 AUTHOR postprocessed map emd_36440_msk_1.map emd_36440_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 512 512 512 -256 -256 -256 512 512 512 875.52 875.52 875.52 90.0 90.0 90.0 X Y Z -2.4131072 8.248597 0.000000005721084 1.0 1.71 1.71 1.71 AUTHOR half map 1 emd_36440_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 512 512 512 -256 -256 -256 512 512 512 875.52 875.52 875.52 90.0 90.0 90.0 X Y Z -2.3186126 8.231275 -0.00000000578031 1.0 1.71 1.71 1.71 AUTHOR half map 2