<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_11_0/emdb.xsd" version="3.0.11.0" emdb_id="EMD-36439">
    <admin>
        <current_status>
            <date>2025-12-24</date>
            <code>REL</code>
            <processing_site>PDBj</processing_site>
        </current_status>
        <sites>
            <deposition>PDBj</deposition>
            <last_processing>PDBj</last_processing>
        </sites>
        <key_dates>
            <deposition>2023-06-06</deposition>
            <header_release>2024-06-12</header_release>
            <map_release>2024-06-12</map_release>
            <update>2025-12-24</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>National Research Foundation (NRF, Singapore)</funding_body>
                <code>NRF-NRFI2016-01</code>
                <country>Singapore</country>
            </grant_reference>
        </grant_support>
        <title>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C</title>
        <authors_list>
            <author ORCID="0000-0002-9990-3335">Fibriansah G</author>
            <author ORCID="0000-0002-1668-8976">Ng TS</author>
            <author ORCID="0000-0002-4046-7380">Tan AWK</author>
            <author ORCID="0000-0003-3810-5302">Shi J</author>
            <author ORCID="0000-0003-4631-8041">Lok SM</author>
        </authors_list>
        <keywords>dengue virus, human antibody, dengue-antibody structure, virus</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author ORCID="0000-0002-9990-3335" order="1">Fibriansah G</author>
                    <author ORCID="0000-0002-1668-8976" order="2">Ng TS</author>
                    <author ORCID="0000-0001-8117-3613" order="3">Lim XN</author>
                    <author order="4">Shebanova A</author>
                    <author ORCID="0000-0003-2413-3863" order="5">Ng LC</author>
                    <author order="6">Tan SL</author>
                    <author ORCID="0000-0002-4046-7380" order="7">Tan AWK</author>
                    <author order="8">Shi J</author>
                    <author ORCID="0000-0002-0049-1079" order="9">Crowe Jr JE</author>
                    <author ORCID="0000-0003-4631-8041" order="10">Lok SM</author>
                    <title>Ultrapotent human antibodies lock E protein dimers central region of diverse DENV3 morphological variants.</title>
                    <journal_abbreviation>Nat Commun</journal_abbreviation>
                    <country>UK</country>
                    <volume>16</volume>
                    <first_page>9182</first_page>
                    <last_page>9182</last_page>
                    <year>2025</year>
                    <external_references type="PUBMED">41102151</external_references>
                    <external_references type="DOI">doi:10.1038/s41467-025-64210-7</external_references>
                    <external_references type="ISSN">2041-1723</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <emdb_list>
            <emdb_reference>
                <emdb_id>EMD-36432</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C (subparticle LLR-LRR)</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36433</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C (subparticle LLR-LRR)</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36434</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of the small tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36435</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of the big tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36440</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-36441</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
                <details>Cryo-EM structure of dengue virus serotype 3 strain CH53489 spherical particle in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </emdb_reference>
        </emdb_list>
        <other_db_list>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36432</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C (subparticle LLR-LRR)</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36433</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C (subparticle LLR-LRR)</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36434</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of the small tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36435</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of the big tail club shape particle of dengue virus serotype 3 strain CH53489 in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36440</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36441</accession_id>
                <content_type>other EM volume</content_type>
                <details>Cryo-EM structure of dengue virus serotype 3 strain CH53489 spherical particle in complex with human antibody DENV-290 Fab at 37 deg C</details>
            </db_reference>
            <db_reference>
                <db_name>EMDB</db_name>
                <accession_id>EMD-36439</accession_id>
                <content_type>associated EM volume</content_type>
            </db_reference>
        </other_db_list>
    </crossreferences>
    <sample>
        <name>Dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Dengue virus serotype 3 strain 863DK in complex with human antibody DENV-290 Fab at 4 deg C</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>4</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="2">
                <name>Dengue virus serotype 3 strain 863DK</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="11069">Dengue virus type 3</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="3">
                <name>Human antibody DENV-290 Fab (heavy and light chain)</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>4</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>Envelope protein</name>
                <natural_source database="NCBI">
                    <organism ncbi="7160">Aedes albopictus</organism>
                </natural_source>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>MRCVGVGNRDFVEGLSGATWVDVVLEHGGCVTTMAKNKPTLDIELQKTEATQLATLRKLCIEGKITNITTDSRCPTQGEA
VLPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLEPIEGKVVQYENLKYTVIITVHTGDQHQVGNETQGVTA
EITPQASTTEAILPEYGTLGLECSPRTGLDFNEMILLTMKNKAWMVHRQWFFDLPLPWASGATTETPTWNRKELLVTFKN
AHAKKQEVVVLGSQEGAMHTALTGATEIQNSGGTSIFAGHLKCRLKMDKLELKGMSYAMCTNTFVLKKEVSETQHGTILI
KVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDNALKINWYKKGSSIGKMF
EATARGARRMAILGDTAWDFGSVGGVLNSLGKMVHQIFGSAYTALFSGVSWVMKIGIGVLLTWIGLNSKNTSMSFSCIAI
GIITLYLGAVVQA</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="2">
                <name>Membrane protein</name>
                <natural_source database="NCBI">
                    <organism ncbi="7160">Aedes albopictus</organism>
                </natural_source>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>SVALAPHVGMGLDTRTQTWMSAEGAWRQVEKVETWALRHPGFTILALFLAHYIGTSLTQKVVIFILLMLVTPSMT</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="3">
                <name>Human antibody DENV-290 heavy chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QVELVESGGDVVQPGKSLRLSCAASGFTFTNYAMHWLRQAPGKGLEWVAVISSDVNDKYYADSVKGRFTISRDNSKNTLY
LQMNSLTPEDTAVYYCAREQAVGTNPWAFDYWGQGTLVTVSS</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="4">
                <name>Human antibody DENV-290 light chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="9606">Homo sapiens</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>HIVMTQSPLSLSVTPGQPASISCKSSQISSWGSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVSDRFSGSGSGTDFTLK
ISRVQAEDVGLYYCMQGLHLPLTFGQGTRLEIK</string>
                </sequence>
            </protein_or_peptide>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <buffer>
                        <ph>8.0</ph>
                        <details>NTE buffer (12 mM Tris-HCl pH 8.0, 120 mM NaCl and 1 mM EDTA)</details>
                    </buffer>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                    </vitrification>
                    <details>The purified virus was mixed with DENV-290 Fab at a molar ratio of 1.5 Fab for every E-protein and then the mixture was incubated at 4 deg C for 30 min.</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>FEI TITAN KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <nominal_defocus_min units="µm">0.5</nominal_defocus_min>
                    <nominal_defocus_max units="µm">5.0</nominal_defocus_max>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>FEI FALCON II (4k x 4k)</film_or_detector_model>
                            <average_electron_dose_per_image units="e/Å^2">18.0</average_electron_dose_per_image>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <ctf_correction>
                    <type>PHASE FLIPPING AND AMPLITUDE CORRECTION</type>
                </ctf_correction>
                <startup_model type_of_model="EMDB MAP">
                    <emdb_id>EMD-5933</emdb_id>
                </startup_model>
                <final_reconstruction>
                    <applied_symmetry>
                        <point_group>I</point_group>
                    </applied_symmetry>
                    <resolution units="Å" res_type="BY AUTHOR">3.5</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>RELION</name>
                        </software>
                    </software_list>
                    <number_images_used>154214</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                        </software>
                    </software_list>
                </final_angle_assignment>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="536871">
        <file>emd_36439.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>512</col>
            <row>512</row>
            <sec>512</sec>
        </dimensions>
        <origin>
            <col>-256</col>
            <row>-256</row>
            <sec>-256</sec>
        </origin>
        <spacing>
            <x>512</x>
            <y>512</y>
            <z>512</z>
        </spacing>
        <cell>
            <a units="Å">875.52</a>
            <b units="Å">875.52</b>
            <c units="Å">875.52</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-7.396718</minimum>
            <maximum>18.475930000000002</maximum>
            <average>0.000000007214275</average>
            <std>1.0</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">1.71</x>
            <y units="Å">1.71</y>
            <z units="Å">1.71</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>2.0</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-36439::::</label>
        <annotation_details>postprocessed map</annotation_details>
    </map>
    <interpretation>
        <segmentation_list>
            <segmentation>
                <file>emd_36439_msk_1.map</file>
            </segmentation>
        </segmentation_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="536871">
                <file>emd_36439_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>512</col>
                    <row>512</row>
                    <sec>512</sec>
                </dimensions>
                <origin>
                    <col>-256</col>
                    <row>-256</row>
                    <sec>-256</sec>
                </origin>
                <spacing>
                    <x>512</x>
                    <y>512</y>
                    <z>512</z>
                </spacing>
                <cell>
                    <a units="Å">875.52</a>
                    <b units="Å">875.52</b>
                    <c units="Å">875.52</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-2.599973</minimum>
                    <maximum>8.916864</maximum>
                    <average>0.000000000424042</average>
                    <std>1.0</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.71</x>
                    <y units="Å">1.71</y>
                    <z units="Å">1.71</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-36439::::</label>
                <annotation_details>half map 2</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="536871">
                <file>emd_36439_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>512</col>
                    <row>512</row>
                    <sec>512</sec>
                </dimensions>
                <origin>
                    <col>-256</col>
                    <row>-256</row>
                    <sec>-256</sec>
                </origin>
                <spacing>
                    <x>512</x>
                    <y>512</y>
                    <z>512</z>
                </spacing>
                <cell>
                    <a units="Å">875.52</a>
                    <b units="Å">875.52</b>
                    <c units="Å">875.52</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-2.619064</minimum>
                    <maximum>8.92605</maximum>
                    <average>-0.000000003131385</average>
                    <std>0.99999994</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.71</x>
                    <y units="Å">1.71</y>
                    <z units="Å">1.71</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-36439::::</label>
                <annotation_details>half map 1</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
