<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_8_0/emdb.xsd" version="3.0.8.0" emdb_id="EMD-27044">
    <admin>
        <current_status>
            <date>2023-08-30</date>
            <code>REL</code>
            <processing_site>RCSB</processing_site>
        </current_status>
        <sites>
            <deposition>RCSB</deposition>
            <last_processing>RCSB</last_processing>
        </sites>
        <key_dates>
            <deposition>2022-05-20</deposition>
            <header_release>2022-08-10</header_release>
            <map_release>2022-08-10</map_release>
            <update>2023-08-30</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>Bill &amp; Melinda Gates Foundation</funding_body>
                <code>INV-021989</code>
                <country>United States</country>
            </grant_reference>
            <grant_reference>
                <funding_body>National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)</funding_body>
                <code>UM1-AI144371</code>
                <country>United States</country>
            </grant_reference>
            <grant_reference>
                <funding_body>National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)</funding_body>
                <code>AI158571</code>
                <country>United States</country>
            </grant_reference>
        </grant_support>
        <title>Negative stain electron microscopy single particle reconstruction of monoclonal antibody VHH7-7-53 Fab in complex with SARS-CoV2 2P spike</title>
        <authors_list>
            <author ORCID="0000-0003-4446-1194">Edwards RJ</author>
            <author ORCID="0000-0001-6232-7330">Mansouri K</author>
        </authors_list>
        <keywords>SARS-CoV2 spike, antibody Fab, VIRAL PROTEIN</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author ORCID="0000-0002-7362-5445" order="1">Luo S</author>
                    <author ORCID="0000-0002-1289-0624" order="2">Zhang J</author>
                    <author ORCID="0000-0002-9774-115X" order="3">Kreutzberger AJB</author>
                    <author ORCID="0000-0003-3064-2947" order="4">Eaton A</author>
                    <author ORCID="0000-0003-4446-1194" order="5">Edwards RJ</author>
                    <author ORCID="0000-0003-0037-2712" order="6">Jing C</author>
                    <author ORCID="0000-0003-4337-9770" order="7">Dai HQ</author>
                    <author ORCID="0000-0003-0391-6594" order="8">Sempowski GD</author>
                    <author ORCID="0000-0002-5984-5978" order="9">Cronin K</author>
                    <author ORCID="0000-0002-6259-7610" order="10">Parks R</author>
                    <author ORCID="0000-0002-1542-0740" order="11">Ye AY</author>
                    <author ORCID="0000-0001-6232-7330" order="12">Mansouri K</author>
                    <author order="13">Barr M</author>
                    <author order="14">Pishesha N</author>
                    <author ORCID="0000-0001-9402-4326" order="15">Williams AC</author>
                    <author ORCID="0000-0003-0145-3290" order="16">Vieira Francisco L</author>
                    <author ORCID="0000-0002-9225-5558" order="17">Saminathan A</author>
                    <author ORCID="0000-0002-5357-8215" order="18">Peng H</author>
                    <author ORCID="0000-0002-0203-0591" order="19">Batra H</author>
                    <author ORCID="0000-0001-9945-1706" order="20">Bellusci L</author>
                    <author ORCID="0000-0002-0593-7965" order="21">Khurana S</author>
                    <author ORCID="0000-0003-0941-0703" order="22">Alam SM</author>
                    <author order="23">Montefiori DC</author>
                    <author ORCID="0000-0001-7399-7954" order="24">Saunders KO</author>
                    <author ORCID="0000-0003-4350-3380" order="25">Tian M</author>
                    <author ORCID="0000-0002-1090-6071" order="26">Ploegh H</author>
                    <author ORCID="0000-0003-0559-893X" order="27">Kirchhausen T</author>
                    <author ORCID="0000-0002-8625-1657" order="28">Chen B</author>
                    <author ORCID="0000-0002-7643-9023" order="29">Haynes BF</author>
                    <author ORCID="0000-0002-0583-1271" order="30">Alt FW</author>
                    <title>An antibody from single human V H -rearranging mouse neutralizes all SARS-CoV-2 variants through BA.5 by inhibiting membrane fusion.</title>
                    <journal_abbreviation>Sci Immunol</journal_abbreviation>
                    <country>US</country>
                    <volume>7</volume>
                    <first_page>eadd5446</first_page>
                    <last_page>eadd5446</last_page>
                    <year>2022</year>
                    <external_references type="PUBMED">35951767</external_references>
                    <external_references type="DOI">doi:10.1126/sciimmunol.add5446</external_references>
                    <external_references type="ISSN">2470-9468</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <emdb_list>
            <emdb_reference>
                <emdb_id>EMD-27043</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
            </emdb_reference>
        </emdb_list>
    </crossreferences>
    <sample>
        <name>Complex of SARS-CoV2 2P spike with VHH7-7-53 antibody Fab</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Complex of SARS-CoV2 2P spike with VHH7-7-53 antibody Fab</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <molecular_weight>
                    <theoretical units="MDa">0.048</theoretical>
                </molecular_weight>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="2">
                <name>SARS-CoV2 2P spike</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="2901879">Severe acute respiratory syndrome coronavirus</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="3">
                <name>VHH7-7-53 Antibody Fab Light Chain, VHH7-7-53 Antibody Fab Heavy Chain</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="10090">Mus musculus</organism>
                </natural_source>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>SARS-CoV2 2P spike</name>
                <natural_source database="NCBI">
                    <organism ncbi="2901879">Severe acute respiratory syndrome coronavirus</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHV
SGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPF
LGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPI
NLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYN
ENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASV
YAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYF
PLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFL
PFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLT
PTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASSVASQSIIAYTMSLG
AENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGI
AVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIG
VTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDI
LSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM
SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT
FVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVA
KNLNESLIDLQELGKYEQGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGRSLEVLFQGPGHHHHHHHHSAW
SHPQFEKGGGSGGGGSGGSAWSHPQFEK</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="2">
                <name>VHH7-7-53 Antibody Heavy Chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="10090">Mus musculus</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QVQLVQSGAEVKKPGASVRVSCKASGFTFTGYQIHWVRQAPGQGLEWMGWINPKSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARRNCDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="3">
                <name>VHH7-7-53 antibody light chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="10090">Mus musculus</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>DIQMTQSPSSLSASVGDRVTITCQASQDISTYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC</string>
                </sequence>
            </protein_or_peptide>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <buffer>
                        <ph>7.4</ph>
                        <component>
                            <concentration units="mMolar">150.0</concentration>
                            <formula>NaCl</formula>
                            <name>Sodium Chloride</name>
                        </component>
                        <component>
                            <concentration units="mMolar">20.0</concentration>
                            <formula>HEPES</formula>
                            <name>HEPES buffer</name>
                        </component>
                        <component>
                            <concentration units="g/dL">5.0</concentration>
                            <formula>glycerol</formula>
                            <name>glycerol</name>
                        </component>
                    </buffer>
                    <staining>
                        <type>NEGATIVE</type>
                        <material>Uranyl formate</material>
                        <details>For negative staining, 5 microliter of the diluted and quenched sample was applied to a freshly glow-discharged, 300 mesh, carbon-coated EM grid and incubated 10-12 s, then rinsed with 70 microliter of 2% uranyl formate delivered in one smooth ejection from a pipet.  The drop of uranyl formate remaining on the grid was allowed to incubate for 60 s, then the grid was blotted with filter paper and allowed to air dry.</details>
                    </staining>
                    <grid>
                        <model>Homemade</model>
                        <material>COPPER</material>
                        <mesh>300</mesh>
                        <support_film film_type_id="1">
                            <film_material>CARBON</film_material>
                            <film_topology>CONTINUOUS</film_topology>
                            <film_thickness>5.0</film_thickness>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">30</time>
                        </pretreatment>
                    </grid>
                    <details>To form the Fab-spike complex, spike was mixed with Fab at a 9:1 molar ratio of fab to spike and incubated at 37  degrees C for 1 h. Then complex was cross-linked by diluting to 200 micrograms/ml spike with 5 g/dl Glycerol in HEPES buffered saline (HBS), containing 20 mM HEPES pH 7.4 and 150 mM NaCl, augmented with 8 mM glutaraldehyde, then incubated 5 min and quenched by addition of sufficient 1 M Tris stock to give 75 mM final Tris concentration and incubated for an additional 5 min.</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>FEI/PHILIPS EM420</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>LAB6</electron_source>
                    <acceleration_voltage units="kV">120</acceleration_voltage>
                    <c2_aperture_diameter units="µm">50.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.0</nominal_cs>
                    <nominal_defocus_min units="µm">0.2</nominal_defocus_min>
                    <nominal_defocus_max units="µm">1.5</nominal_defocus_max>
                    <nominal_magnification>49000.0</nominal_magnification>
                    <specimen_holder_model>SIDE ENTRY, EUCENTRIC</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <alignment_procedure>
                        <basic/>
                    </alignment_procedure>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>OTHER</film_or_detector_model>
                            <digitization_details>
                                <dimensions>
                                    <width units="pixel">8736</width>
                                    <height units="pixel">8740</height>
                                </dimensions>
                            </digitization_details>
                            <number_grids_imaged>1</number_grids_imaged>
                            <number_real_images>101</number_real_images>
                            <average_exposure_time units="s">0.25</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">32.0</average_electron_dose_per_image>
                            <details>Images were collected with a minimal dose approach with the beam blanked except during initial grid orientation and image collection.  To create an initial atlas, the entire grid was imaged once at 49x magnification at very low beam intensity by decreasing the emission current, strongly focusing C1 (Spot Size 6) and defocusing C2 (Intensity knob fully clockwise). The stage was then quickly translated to center the desired gridsquare, with an estimated exposure of &lt; 2 s at this very low illumination level, at which point the beam was blanked.  A 3,300x magnification was then selected so that a single gridsquare approximately fills the scintillator screen.  The beam was then unblanked and the stage manually tilted and the eucentric height quickly adjusted by noting the movement of the gridbars, and then the stage was translated to center on the lower-left corner of the gridsquare, with an estimated exposure of &lt; 2 s at this very low illumination level, at which point the beam was blanked.  A magnfication of 49,000x was then selected and C2 focused by a known number of clicks of the Intensity knob so that the beam would approximately fill the scintillator screen.  The beam was then unblanked, the objective lens focused by eye and then adjusted to approximately 0.5 micron underfocused, and C2 adjusted so the beam just filled the scintillator screen.  Because this focusing step involved a long exposure to the focused beam, no data was collected in this area.  For data collection, the stage was translated blindly, with the beam blanked, by noting the micrometer markings on the left-hand stage control, to move to an un-irradiated area that was approximately two screen-widths vertically away from the initial position.  The beam was then unblanked, an image captured with 0.25 s exposure to the focused beam without any adjustment of the objective lens focus, and the beam then re-blanked.  The FFT of the collected image was examined and the position of the first Thon ring noted and the objective lens focus adjusted if needed for subsequent images.  The stage was then moved blindly in the same direction to an un-irradiated area and a new image collected.  In this way images were collected until the gridbar was encountered, at which point the beam was unblanked and the stage moved so that the gridbar occluded all of the beam except a small sliver of the gridsquare at the bottom or top of the screen, and the right hand stage control was used to translate the specimen to a new location at least two screen widths away horizontally.  In this way the entire gridsquare could be imaged in a rastered fashion with each area only irradiated with the full strength beam during the 0.25 s image capture.</details>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <particle_selection>
                    <number_selected>565030</number_selected>
                </particle_selection>
                <startup_model type_of_model="INSILICO MODEL">
                    <insilico_model>An unliganded (no Fab) Env trimer homology model was built with SwissModel using the CH505 sequence and PDB 5UM8 as template, then converted to a map using UCSF Chimera's molmap function with 15 angstrom resolution and 2.4 angstrom gridspacing</insilico_model>
                    <details>The starting model was further low-pass filtered to 60 angstroms for use in 3D classification.  Resulting 3D classification map was used for as starting model for final 3d refinements.</details>
                </startup_model>
                <final_reconstruction>
                    <number_classes_used>1</number_classes_used>
                    <applied_symmetry>
                        <point_group>C1</point_group>
                    </applied_symmetry>
                    <algorithm>BACK PROJECTION</algorithm>
                    <resolution units="Å" res_type="BY AUTHOR">14.2</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                    <number_images_used>11357</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                </final_angle_assignment>
                <final_three_d_classification>
                    <number_classes>12</number_classes>
                    <average_number_members_per_class>15605.0</average_number_members_per_class>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                </final_three_d_classification>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="16385">
        <file>emd_27044.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>160</col>
            <row>160</row>
            <sec>160</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>160</x>
            <y>160</y>
            <z>160</z>
        </spacing>
        <cell>
            <a units="Å">384.0</a>
            <b units="Å">384.0</b>
            <c units="Å">384.0</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.046943307</minimum>
            <maximum>0.08149781</maximum>
            <average>0.00026375407</average>
            <std>0.0074621835</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">2.4</x>
            <y units="Å">2.4</y>
            <z units="Å">2.4</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.032</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-27044::::</label>
        <annotation_details>Final sharpened map of negative stain electron microscopy single particle reconstruction of monoclonal antibody VHH7-7-53 Fab in complex with SARS-CoV2 2P spike</annotation_details>
    </map>
    <interpretation>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="16385">
                <file>emd_27044_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>160</col>
                    <row>160</row>
                    <sec>160</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>160</x>
                    <y>160</y>
                    <z>160</z>
                </spacing>
                <cell>
                    <a units="Å">384.0</a>
                    <b units="Å">384.0</b>
                    <c units="Å">384.0</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.049755182</minimum>
                    <maximum>0.08825818</maximum>
                    <average>0.00026208747</average>
                    <std>0.0076500806</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">2.4</x>
                    <y units="Å">2.4</y>
                    <z units="Å">2.4</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-27044::::</label>
                <annotation_details>Half-map 2 of negative stain electron microscopy single particle reconstruction of monoclonal antibody VHH7-7-53 Fab in complex with SARS-CoV2 2P spike</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="16385">
                <file>emd_27044_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>160</col>
                    <row>160</row>
                    <sec>160</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>160</x>
                    <y>160</y>
                    <z>160</z>
                </spacing>
                <cell>
                    <a units="Å">384.0</a>
                    <b units="Å">384.0</b>
                    <c units="Å">384.0</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.053502493</minimum>
                    <maximum>0.08722641</maximum>
                    <average>0.00026542068</average>
                    <std>0.007651302</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">2.4</x>
                    <y units="Å">2.4</y>
                    <z units="Å">2.4</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-27044::::</label>
                <annotation_details>Half-map 1 of negative stain electron microscopy single particle reconstruction of monoclonal antibody VHH7-7-53 Fab in complex with SARS-CoV2 2P spike</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
