<?xml version="1.0" encoding="UTF-8"?>
<emd emdb_id="EMD-24621" version="3.0.2.10">
    <admin>
        <current_status>
            <date>2023-03-08</date>
            <code>REL</code>
            <processing_site>RCSB</processing_site>
        </current_status>
        <sites>
            <deposition>RCSB</deposition>
            <last_processing>RCSB</last_processing>
        </sites>
        <key_dates>
            <deposition>2021-08-04</deposition>
            <header_release>2021-08-25</header_release>
            <map_release>2021-08-25</map_release>
            <update>2023-03-08</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)</funding_body>
                <code>UM1-AI144371</code>
                <country>United States</country>
            </grant_reference>
        </grant_support>
        <title>Negative stain electron microscopy single particle reconstruction of monoclonal antibody DH1027 Fab in complex with HIV-1 Env CH505 SOSIP trimer.</title>
        <authors_list>
            <author>Edwards RJ</author>
            <author>Mansouri K</author>
        </authors_list>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author ORCID="0000-0001-7399-7954" order="1">Saunders KO</author>
                    <author ORCID="0000-0003-4446-1194" order="2">Edwards RJ</author>
                    <author ORCID="0000-0003-2107-1580" order="3">Tilahun K</author>
                    <author ORCID="0000-0002-7218-4852" order="4">Manne K</author>
                    <author ORCID="0000-0002-2517-6331" order="5">Lu X</author>
                    <author ORCID="0000-0002-5988-6729" order="6">Cain DW</author>
                    <author ORCID="0000-0001-9933-9618" order="7">Wiehe K</author>
                    <author ORCID="0000-0002-2970-7259" order="8">Williams WB</author>
                    <author ORCID="0000-0001-6232-7330" order="9">Mansouri K</author>
                    <author ORCID="0000-0001-5498-3469" order="10">Hernandez GE</author>
                    <author ORCID="0000-0003-4119-3884" order="11">Sutherland L</author>
                    <author ORCID="0000-0002-6361-3758" order="12">Scearce R</author>
                    <author ORCID="0000-0002-6259-7610" order="13">Parks R</author>
                    <author order="14">Barr M</author>
                    <author order="15">DeMarco T</author>
                    <author ORCID="0000-0002-4272-8409" order="16">Eater CM</author>
                    <author ORCID="0000-0003-3064-2947" order="17">Eaton A</author>
                    <author ORCID="0000-0002-6675-8004" order="18">Morton G</author>
                    <author ORCID="0000-0002-0645-6047" order="19">Mildenberg B</author>
                    <author ORCID="0000-0002-3205-6338" order="20">Wang Y</author>
                    <author ORCID="0000-0001-5183-6949" order="21">Rountree RW</author>
                    <author order="22">Tomai MA</author>
                    <author ORCID="0000-0002-4644-2619" order="23">Fox CB</author>
                    <author ORCID="0000-0002-3890-5855" order="24">Moody MA</author>
                    <author ORCID="0000-0003-0941-0703" order="25">Alam SM</author>
                    <author ORCID="0000-0002-8796-1714" order="26">Santra S</author>
                    <author ORCID="0000-0001-7852-0135" order="27">Lewis MG</author>
                    <author order="28">Denny TN</author>
                    <author ORCID="0000-0002-2338-4532" order="29">Shaw GM</author>
                    <author order="30">Montefiori DC</author>
                    <author ORCID="0000-0002-0089-277X" order="31">Acharya P</author>
                    <author ORCID="0000-0002-7643-9023" order="32">Haynes BF</author>
                    <title>Stabilized HIV-1 envelope immunization induces neutralizing antibodies to the CD4bs and protects macaques against mucosal infection.</title>
                    <journal_abbreviation>Sci Transl Med</journal_abbreviation>
                    <country>US</country>
                    <volume>14</volume>
                    <first_page>eabo5598</first_page>
                    <last_page>eabo5598</last_page>
                    <year>2022</year>
                    <external_references type="PUBMED">36070369</external_references>
                    <external_references type="DOI">doi:10.1126/scitranslmed.abo5598</external_references>
                    <external_references type="ISSN">1946-6242</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <emdb_list>
            <emdb_reference>
                <emdb_id>EMD-24619</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-24620</emdb_id>
                <relationship>
                    <other>other EM volume</other>
                </relationship>
            </emdb_reference>
            <emdb_reference>
                <emdb_id>EMD-24621</emdb_id>
                <relationship>
                    <other>associated EM volume</other>
                </relationship>
            </emdb_reference>
        </emdb_list>
    </crossreferences>
    <sample>
        <name>Complex of HIV Env CH505TFchim.6R.SOSIP.664.v4.1 with DH1027 antibody Fab</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Complex of HIV Env CH505TFchim.6R.SOSIP.664.v4.1 with DH1027 antibody Fab</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="11709">Human immunodeficiency virus 2</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.023</theoretical>
                </molecular_weight>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="2">
                <name>HIV Env CH505TFchim.6R.SOSIP.664.v4.1 trimer</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="11709">Human immunodeficiency virus 2</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="3">
                <name>DH1027 Antibody Fab</name>
                <parent>1</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9544">Macaca mulatta</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="4">
                <name>DH1027 Antibody Fab Heavy Chain</name>
                <parent>3</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>2</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9544">Macaca mulatta</organism>
                </natural_source>
            </complex_supramolecule>
            <complex_supramolecule supramolecule_id="5">
                <name>DH1027 Antibody Fab Light Chain</name>
                <parent>3</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>3</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <natural_source database="NCBI">
                    <organism ncbi="9544">Macaca mulatta</organism>
                </natural_source>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>HIV Env CH505TFchim.6R.SOSIP.664.v4.1</name>
                <natural_source database="NCBI">
                    <organism ncbi="11676">Human immunodeficiency virus 1</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>AENLWVTVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVLKNVTENFNMWKNDMVDQMHEDVISLWDQSLKPCVKLTPLCVTLNCTNATASNSSIIEGMKNCSFNITTELRDKREKKNALFYKLDIVQLDGNSSQYRLINCNTSVITQACPKVSFDPIPIHYCAPAGYAILKCNNKTFTGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENITNNVKTIIVHLNESVKIECTRPNNKTRTSIRIGPGQAFYATGQVIGDIREAYCNINESKWNETLQRVSKKLKEYFPHKNITFQPSSGGDLEITTHSFNCGGEFFYCNTSSLFNRTYMANSTDMANSTETNSTRTITIHCRIKQIINMWQEVGRAMYAPPIAGNITCISNITGLLLTRDGGKNNTETFRPGGGNMKDNWRSELYKYKVVKIEPLGVAPTRCKRRVVGRRRRRRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGIVQQQSNLLRAPEAQQHLLKLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="2">
                <name>DH1027 Antibody Fab Heavy Chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="9544">Macaca mulatta</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>QVQLQESGPGLVKPSETLSLTCTVSGGSINRNYWSWIRQAPGKGLEWIGRIFPDSGSTDYNPSLKSRVTISTDTSKNQFSLRLTSVTVADTAVYYCAREGPTADWLLWYNWFDVRGPGVLVTVSS
astkg psvfplapss rstsestaal gclvkdyfpe pvtvswnsgs ltsgvhtfpa
vlqssglysl ssvvtvpsss lgtqtyvcnv nhkpsntkvd krveiktcgg</string>
                </sequence>
            </protein_or_peptide>
            <protein_or_peptide macromolecule_id="3">
                <name>DH1027 Antibody Fab Light Chain</name>
                <natural_source database="NCBI">
                    <organism ncbi="9544">Macaca mulatta</organism>
                </natural_source>
                <recombinant_expression database="NCBI">
                    <recombinant_organism ncbi="9606">Homo sapiens</recombinant_organism>
                </recombinant_expression>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>DIQMTQSPSSLSASEGDTVTITCRASRAISNDLAWYQQKPGETPRVLIHGASSLKSGTPSRFRGSGSGTDFTLTISSLQPEDFATYYCQQYSSIPYTFGQGTEVDMK
gqpkasptvt
lfppsseelq ankatlvcli sdfypgvvkv awkadgsavn agvetttpsk qsnnkyaass
ylsltsdqwk shksyscqvt hegstvektv apaecs</string>
                </sequence>
            </protein_or_peptide>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>singleParticle</method>
            <aggregation_state>particle</aggregation_state>
            <specimen_preparation_list>
                <single_particle_preparation preparation_id="1">
                    <concentration units="mg/mL">0.8</concentration>
                    <buffer>
                        <ph>7.4</ph>
                        <component>
                            <concentration units="mM">20.0</concentration>
                            <formula>HEPES</formula>
                            <name>N-2-Hydroxyethyl-piperazine-N-2-ethanesulfonic acid</name>
                        </component>
                        <component>
                            <concentration units="mM">150.0</concentration>
                            <formula>NaCl</formula>
                            <name>sodium chloride</name>
                        </component>
                        <component>
                            <concentration units="g/dL">5.0</concentration>
                            <formula>glycerol</formula>
                            <name>glycerol</name>
                        </component>
                    </buffer>
                    <staining>
                        <type>NEGATIVE</type>
                        <material>uranyl formate</material>
                        <details>For negative staining, 5 microliter of the diluted filter retentate was applied to a freshly glow-discharged, 300 mesh, carbon-coated EM grid and incubated 10-12 s, then rinsed with 70 microliter of 2% uranyl formate delivered in one smooth ejection from a pipet.  The drop of uranyl formate remaining on the grid was allowed to incubate for 60 s, then the grid was blotted with filter paper and allowed to air dry.</details>
                    </staining>
                    <grid>
                        <model>Homemade</model>
                        <material>COPPER</material>
                        <mesh>300</mesh>
                        <support_film film_type_id="1">
                            <film_material>CARBON</film_material>
                            <film_topology>CONTINUOUS</film_topology>
                            <film_thickness units="nm">5.0</film_thickness>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">30</time>
                        </pretreatment>
                    </grid>
                    <details>Frozen aliquots of SOSIP and Fab were thawed in an Aluminum block at room temperature for 2-3 minutes, then 10 microgram of SOSIP were mixed with 36 microgram Fab (~1:15 molar ratio) and diluted to 100 microliter final volume with HEPES-buffered saline (HBS), containing 20 mM HEPES buffer and 150 mM NaCl, pH 7.4, augmented with 5% glycerol.  Mixture was incubated at 22 degrees C overnight.  The following day, a 0.08% glutaraldehyde fixative was prepared by diluting an 8% stock 1/100 with HBS. Then 400 microliter of fixative was added to the SOSIP-Fab mixture and incubated 5 min at room temperature to crosslink the complex, followed by addition of 40 microliter of a 1 M Tris solution, pH 7.4 to quench any unreacted glutaraldehyde.  The reaction mixture was then transferred to a 0.5-ml Amicon Ultra centrifugal filter device with a 100-kDa cutoff filter (Millipore, #UFC510096) and spun 10 min at 14,000 g in a benchtop centrifuge held at 20 degrees C to remove excess Fab. The filter retentate, usually ~25 microliter, was collected and diluted 1:1 with HBS augmented with 5% glycerol.</details>
                </single_particle_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <single_particle_microscopy microscopy_id="1">
                    <microscope>FEI/PHILIPS EM420</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>LAB6</electron_source>
                    <acceleration_voltage units="kV">120</acceleration_voltage>
                    <c2_aperture_diameter units="µm">50.0</c2_aperture_diameter>
                    <nominal_cs units="mm">2.0</nominal_cs>
                    <nominal_defocus_min units="µm">0.2</nominal_defocus_min>
                    <nominal_defocus_max units="µm">1.5</nominal_defocus_max>
                    <nominal_magnification>82000.0</nominal_magnification>
                    <specimen_holder_model>SIDE ENTRY, EUCENTRIC</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <alignment_procedure>
                        <basic/>
                    </alignment_procedure>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>OTHER</film_or_detector_model>
                            <digitization_details>
                                <dimensions>
                                    <width units="pixel">2048</width>
                                    <height units="pixel">2048</height>
                                </dimensions>
                            </digitization_details>
                            <number_grids_imaged>1</number_grids_imaged>
                            <number_real_images>209</number_real_images>
                            <average_exposure_time units="s">0.25</average_exposure_time>
                            <average_electron_dose_per_image units="e/Å^2">32.0</average_electron_dose_per_image>
                            <details>Images were collected with a minimal dose approach using a manually controlled low dose unit to keep the beam blanked except during initial grid orientation and image collection.  To create an initial atlas, the entire grid was imaged once at 49x magnification at very low beam intensity by decreasing the emission current, strongly focusing C1 (Spot Size 6) and defocusing C2 (Intensity knob fully clockwise). The stage was then quickly translated to center the desired gridsquare, with an estimated exposure of &lt; 2 s at this very low illumination level, at which point the beam was blanked.  A 3,300x magnification was then selected so that a single gridsquare approximately fills the scintillator screen.  The beam was then unblanked and the stage manually tilted and the eucentric height quickly adjusted by noting the movement of the gridbars, and then the stage was translated to center on the lower-left corner of the gridsquare, with an estimated exposure of &lt; 2 s at this very low illumination level, at which point the beam was blanked.  A magnfication of 82,000x was then selected and C2 focused by a known number of clicks of the Intensity knob so that the beam would approximately fill the scintillator screen.  The beam was then unblanked, the objective lens focused by eye and then adjusted to approximately 0.5 micron underfocused, and C2 adjusted so the beam just filled the scintillator screen.  Because this focusing step involved a long exposure to the focused beam, no data was collected in this area.  For data collection, the stage was translated blindly, with the beam blanked, by noting the micrometer markings on the left-hand stage control, to move to an un-irradiated area that was approximately two screen-widths vertically away from the initial position.  The beam was then unblanked, an image captured with 0.25 s exposure to the focused beam without any adjustment of the objective lens focus, and the beam then re-blanked.  The FFT of the collected image was examined and the position of the first Thon ring noted and the objective lens focus adjusted if needed for subsequent images.  The stage was then moved blindly in the same direction to an un-irradiated area and a new image collected.  In this way images were collected until the gridbar was encountered, at which point the beam was unblanked and the stage moved so that the gridbar occluded all of the beam except a small sliver of the gridsquare at the bottom or top of the screen, and the right hand stage control was used to translate the specimen to a new location at least two screen widths away horizontally.  In this way the entire gridsquare could be imaged in a rastered fashion with each area only irradiated with the full strength beam during the 0.25 s image capture.</details>
                        </image_recording>
                    </image_recording_list>
                </single_particle_microscopy>
            </microscopy_list>
            <singleparticle_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <particle_selection>
                    <number_selected>116047</number_selected>
                </particle_selection>
                <startup_model type_of_model="INSILICO MODEL">
                    <insilico_model>An unliganded (no Fab) Env trimer homology model was built with SwissModel using the CH505 sequence and PDB 5UM8 as template, then converted to a map using UCSF Chimera's molmap function with 15 angstrom resolution and 4.02 angstrom gridspacing</insilico_model>
                    <details>The starting model was further low-pass filtered to 60 angstroms for use in 3D classification.  Resulting 3D classification map was used for as starting model for final 3d refinements.</details>
                </startup_model>
                <final_reconstruction>
                    <number_classes_used>1</number_classes_used>
                    <algorithm>EXACT BACK PROJECTION</algorithm>
                    <resolution units="Å" res_type="BY AUTHOR">18.4</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                    <number_images_used>9465</number_images_used>
                </final_reconstruction>
                <initial_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                </initial_angle_assignment>
                <final_angle_assignment>
                    <type>MAXIMUM LIKELIHOOD</type>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                </final_angle_assignment>
                <final_three_d_classification>
                    <number_classes>4</number_classes>
                    <average_number_members_per_class>7042.0</average_number_members_per_class>
                    <software_list>
                        <software>
                            <name>RELION</name>
                            <version>3.0</version>
                        </software>
                    </software_list>
                </final_three_d_classification>
            </singleparticle_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="3539">
        <file>emd_24621.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>96</col>
            <row>96</row>
            <sec>96</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>96</x>
            <y>96</y>
            <z>96</z>
        </spacing>
        <cell>
            <a units="Å">385.91998</a>
            <b units="Å">385.91998</b>
            <c units="Å">385.91998</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-0.05437254</minimum>
            <maximum>0.15789023</maximum>
            <average>0.0007256831</average>
            <std>0.010688271</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">4.02</x>
            <y units="Å">4.02</y>
            <z units="Å">4.02</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.0615</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-24621::::</label>
        <annotation_details>Final sharpened map of negative stain electron microscopy single particle reconstruction of monoclonal antibody DH1027 Fab in complex with HIV-1 Env CH505 SOSIP trimer.</annotation_details>
    </map>
    <interpretation>
        <additional_map_list>
            <additional_map format="CCP4" size_kbytes="3539">
                <file>emd_24621_additional_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>96</col>
                    <row>96</row>
                    <sec>96</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>96</x>
                    <y>96</y>
                    <z>96</z>
                </spacing>
                <cell>
                    <a units="Å">385.91998</a>
                    <b units="Å">385.91998</b>
                    <c units="Å">385.91998</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.053331666</minimum>
                    <maximum>0.15822263</maximum>
                    <average>0.00073584414</average>
                    <std>0.010655587</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">4.02</x>
                    <y units="Å">4.02</y>
                    <z units="Å">4.02</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-24621::::</label>
                <annotation_details>Raw, unsharpened map of negative stain electron microscopy single particle reconstruction of monoclonal antibody DH1027 Fab in complex with HIV-1 Env CH505 SOSIP trimer.</annotation_details>
            </additional_map>
        </additional_map_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="3539">
                <file>emd_24621_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>96</col>
                    <row>96</row>
                    <sec>96</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>96</x>
                    <y>96</y>
                    <z>96</z>
                </spacing>
                <cell>
                    <a units="Å">385.91998</a>
                    <b units="Å">385.91998</b>
                    <c units="Å">385.91998</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.063809164</minimum>
                    <maximum>0.16581815</maximum>
                    <average>0.000720986</average>
                    <std>0.01104107</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">4.02</x>
                    <y units="Å">4.02</y>
                    <z units="Å">4.02</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-24621::::</label>
                <annotation_details>Half-map 1 of negative stain electron microscopy single particle reconstruction of monoclonal antibody DH1027 Fab in complex with HIV-1 Env CH505 SOSIP trimer.</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="3539">
                <file>emd_24621_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>96</col>
                    <row>96</row>
                    <sec>96</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>96</x>
                    <y>96</y>
                    <z>96</z>
                </spacing>
                <cell>
                    <a units="Å">385.91998</a>
                    <b units="Å">385.91998</b>
                    <c units="Å">385.91998</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.06029093</minimum>
                    <maximum>0.16522467</maximum>
                    <average>0.0007303803</average>
                    <std>0.011023277</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">4.02</x>
                    <y units="Å">4.02</y>
                    <z units="Å">4.02</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-24621::::</label>
                <annotation_details>Half-map 2 of negative stain electron microscopy single particle reconstruction of monoclonal antibody DH1027 Fab in complex with HIV-1 Env CH505 SOSIP trimer.</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
