2024-05-29 REL RCSB RCSB RCSB 2020-12-28 2022-01-12 2022-01-12 2024-05-29 National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS) R01 NS097490 United States National Institutes of Health/National Institute on Aging (NIH/NIA) R01 AG054025 United States National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS) R01 NS094557 United States Hojjatian A Dasari A Sengupta U Taylor D Daneshparvar N Abbasi Yeganeh F Dillard L Michael B Griffin R Borgnia M Kayed R Taylor K Lim K neurodegenerative diseases, TEM, DARR, dipolar assisted rotational resonance, PROTEIN FIBRIL Hojjatian A Dasari A Sengupta U Taylor D Daneshparvar N Abbasi Yeganeh F Dillard L Michael B Griffin R Borgnia M Kayed R Taylor K Lim K To Be Published 0353 7l7h FULLOVERLAP Alpha-synuclein in the presence of Tau Alpha-synuclein in the presence of Tau 0 1 Homo sapiens 118.5 Alpha-synuclein Homo sapiens 0.014476108 8 Escherichia coli LEVO MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA P37840 helical filament 7.4 ETHANE-PROPANE FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 GATAN K3 (6k x 4k) 45.0 1 2.43 -179.3 C1 4.0 FSC 0.143 CUT-OFF RELION 3.0 243181 1043263 NOT APPLICABLE RELION 3