2025-05-14 REL RCSB INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY EXPERIMENTAL_SUMMARY em_admin em_software _em_admin.last_update _em_software.name COORDINATE_REPLACEMENT AUTHOR Sequence discrepancy
The sequence used for the original model was taken from the literature reference; it was created during quarantine and I did not have access to the lab-confirmed sequence. There are two amino acids different between these two reference sequences. The correct sequence corresponds to UniProt code P36544, while the literature cites U40583.1. The amino acids have been changed accordingly.
STRUCTURE_SUMMARY atom_site em_software entity entity_poly entity_poly_seq pdbx_branch_scheme pdbx_nonpoly_scheme pdbx_poly_seq_scheme pdbx_struct_assembly_prop pdbx_struct_conn_angle pdbx_validate_close_contact pdbx_validate_rmsd_angle pdbx_validate_torsion refine_ls_restr software struct struct_conn struct_mon_prot_cis struct_ref_seq_dif struct_sheet_range _em_software.category _entity.formula_weight _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly_seq.mon_id _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_struct_assembly_prop.value _pdbx_struct_conn_angle.value _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi _refine_ls_restr.dev_ideal _refine_ls_restr.number _software.version _struct.pdbx_descriptor _struct_conn.pdbx_dist_value _struct_mon_prot_cis.pdbx_omega_angle _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_seq_id _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_seq_id DATABASE_REFERENCES citation _citation.journal_volume _citation.page_first STRUCTURE_SUMMARY chem_comp_atom chem_comp_bond database_2 em_admin pdbx_entry_details pdbx_modification_feature _database_2.pdbx_DOI _database_2.pdbx_database_accession _em_admin.current_status _em_admin.last_update _pdbx_entry_details.has_protein_modification DATA_COLLECTION em_admin em_software _em_admin.last_update _em_software.name RCSB RCSB 2020-11-10 2021-03-17 2021-03-17 2025-05-14 National Institutes of Health/National Institute of Mental Health (NIH/NIMH) NS095899 United States National Institutes of Health/National Institute of Mental Health (NIH/NIMH) NS077983 United States Alpha-7 nicotinic acetylcholine receptor bound to epibatidine and PNU-120596 in the activated state Noviello CM Hibbs RE Cys-loop receptor, MEMBRANE PROTEIN Noviello CM Gharpure A Mukhtasimova N Cabuco R Baxter L Borek D Sine SM Hibbs RE Structure and gating mechanism of the alpha 7 nicotinic acetylcholine receptor. Cell 184 2121 2021 33735609 doi:10.1016/j.cell.2021.02.049 1097-4172 7kox FULLOVERLAP alpha-7 nicotinic receptor in complex with epibatidine and PNU-120596 alpha-7 nicotinic receptor in complex with epibatidine and PNU-120596 0 1 Homo sapiens Neuronal acetylcholine receptor subunit alpha-7,Soluble cytochrome b562 fusion Homo sapiens 0.063832293 5 Homo sapiens LEVO EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFP DGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKIS LGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL RMKRPGEDKVRPACQHKQRRCSLASVEMAGAMADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKL EDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLCGRMACSPTHDEHLLHGGQPPE GDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFAWSHPQF EK P36544 P0ABE7 P36544 2-acetamido-2-deoxy-beta-D-glucopyranose 0.000221208 10 NAG EPIBATIDINE 0.000208687 5 EPJ CALCIUM ION 4.0078e-05 5 CA water 1.8015e-05 5 HOH singleParticle particle 7.4 ETHANE FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 GATAN K3 (6k x 4k) 45.0 1 PHASE FLIPPING AND AMPLITUDE CORRECTION 2.7 FSC 0.143 CUT-OFF 2004527 RANDOM ASSIGNMENT MAXIMUM LIKELIHOOD emd_22983.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 298.8 298.8 298.8 90.0 90.0 90.0 X Y Z -0.026316755 0.06518166 0.00012750176 0.0014009395 0.83 0.83 0.83 0.007 AUTHOR Alpha-7 nicotinic acetylcholine receptor bound to epibatidine and PNU-120596 in the activated state emd_22983_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 298.8 298.8 298.8 90.0 90.0 90.0 X Y Z -0.011716889 0.039508782 0.0000048710845 0.0011295081 0.83 0.83 0.83 AUTHOR Alpha-7 nicotinic acetylcholine receptor bound to epibatidine and PNU-120596 in the activated state emd_22983_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 298.8 298.8 298.8 90.0 90.0 90.0 X Y Z -0.01240911 0.04020315 0.000007556696 0.0012112006 0.83 0.83 0.83 AUTHOR Alpha-7 nicotinic acetylcholine receptor bound to epibatidine and PNU-120596 in the activated state emd_22983_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 360 360 360 0 0 0 360 360 360 298.8 298.8 298.8 90.0 90.0 90.0 X Y Z -0.012728505 0.04047814 0.000007925267 0.0012105603 0.83 0.83 0.83 AUTHOR Alpha-7 nicotinic acetylcholine receptor bound to epibatidine and PNU-120596 in the activated state