2024-03-06 REL RCSB RCSB RCSB 2020-06-27 2020-12-23 2020-12-23 2024-03-06 National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R01GM104540 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R01GM104540-03S1 United States National Science Foundation (NSF, United States) 0923395 United States National Institutes of Health/Office of the Director S10 OD018142-01 United States National Institutes of Health/National Center for Research Resources (NIH/NCRR) S10 RR025080-01 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) U24 GM116788 United States Caulobacter crescentus FljK filament, straightened Montemayor EJ Ploscariu NT flagellum, flagellin, filament, helical, Caulobacter, motility, STRUCTURAL PROTEIN Montemayor EJ Ploscariu NT Sanchez JC Parrell D Dillard RS Shebelut CW Ke Z Guerrero-Ferreira RC Wright ER Flagellar Structures from the Bacterium Caulobacter crescentus and Implications for Phage phi CbK Predation of Multiflagellin Bacteria J.Bacteriol. US 203 2021 33288623 doi:10.1128/JB.00399-20 1098-5530 0767 JOBAAY 6xky FULLOVERLAP straightened FljK filament straightened FljK filament 0 1 Caulobacter vibrioides NA1000 Flagellin Caulobacter vibrioides (strain NA1000 / CB15N) NA1000 / CB15N 0.027997381 20 LEVO MALNSINTNAGAMIALQNLNGTNSELTTVQQRINTGKKIASAKDNGAIWATAKNQSATAASMNAVKDSLQRGQSTIDVAL AAGDTITDLLGKMKEKALAASDCSLNTASFNALKSDFDSLRDQIEKAATSAKFNGVSIADGSTTKLTFLANSDGSGFTVN AKTISLAGIGLTTTSTFTTAAAAKTMIGTIDTALQTATNKLASLGTSSVGLDTHLTFVGKLQDSLDAGVGNLVDADLAKE SAKLQSLQTKQQLGVQALSIANQSSSSILSLFR A0A0H3C7K6 helical filament 7.4 ETHANE TFS KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 GATAN K3 (6k x 4k) 60.0 1 4.9 65.2 C1 3.2 FSC 0.143 CUT-OFF RELION 3.1 59868
featureless cylinder
 NOT APPLICABLE RELION 3.1 emd_22229.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 278.4 278.4 278.4 90.0 90.0 90.0 X Y Z -0.04990608 0.08955884 0.00033102697 0.0052644177 0.87 0.87 0.87 0.0203 AUTHOR sharpened map, masked OTHER Phenix Refine REAL 30.600000000000001 emd_22229_msk_1.map emd_22229_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 278.4 278.4 278.4 90.0 90.0 90.0 X Y Z -0.018431006 0.04168029 -0.0000013426312 0.003323821 0.87 0.87 0.87 AUTHOR unsharpened map, masked emd_22229_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 278.4 278.4 278.4 90.0 90.0 90.0 X Y Z -0.08451512 0.09913985 -0.000003175176 0.011727488 0.87 0.87 0.87 AUTHOR half map 2 emd_22229_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 320 320 320 0 0 0 320 320 320 278.4 278.4 278.4 90.0 90.0 90.0 X Y Z -0.08383049 0.10835975 -0.0000024165706 0.011761496 0.87 0.87 0.87 AUTHOR half map 1