2024-03-06 REL RCSB RCSB RCSB 2020-06-05 2020-07-01 2020-07-01 2024-03-06 National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R00GM112982 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R35GM128777 United States Other private PEW-00033055 United States American Heart Association 20POST35210202 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) T32 GM088118 United States Other private DFS 20 16 United States Other private SF349247 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) GM103310 United States Other private F00316 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) OD019994 United States National Institutes of Health/National Center for Research Resources (NIH/NCRR) U24GM129547 United States National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI) GM103311 United States Cryo-EM structure of MlaFEDB in nanodiscs with phospholipid substrates Coudray N Isom GL lipid transport, bacterial cell envelope, mla pathway, MCE Coudray N Isom GL MacRae MR Saiduddin MN Bhabha G Ekiert DC Structure of bacterial phospholipid transporter MlaFEDB with substrate bound. Elife US 9 2020 33236984 doi:10.7554/eLife.62518 2050-084X 6xbd FULLOVERLAP MlaFEDB complex with two bound phospholipid substrates in MSP1D1 nanodisc MlaFEDB complex with two bound phospholipid substrates in MSP1D1 nanodisc 0 1 2 3 4 5 Escherichia coli K-12 0.266 Phospholipid ABC transporter-binding protein MlaD Escherichia coli DEC6A 0.021937673999999997 6 Escherichia coli Rosetta 2 (DE3) LEVO MHHHHHHQHQHENLYFQGMQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGG VVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAMV LEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK H4UPP8 Phospholipid ABC transporter permease protein MlaE Escherichia coli DEC6A 0.027885161999999998 2 Escherichia coli Rosetta 2 (DE3) LEVO MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIVVSGVFIGMVLGLQGYLVLTT YSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEIGLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTV IFVAVGIWGGSLVGVSWKGIDSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV HSSLAVLGLDFVLTALMFGN H4UPP9 Phospholipid transport system ATP-binding protein MlaF Escherichia coli DEC6A 0.029128801 2 Escherichia coli Rosetta 2 (DE3) LEVO MEQSVANLVDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRL YTVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIA LEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWILADKKIVAHGSAQALQANPDPRV RQFLDGIADGPVPFRYPAGDYHADLLPGS H4UPQ0 3.6.3.- Phospholipid ABC transporter-binding protein MlaB Escherichia coli K-12 0.010690313 2 Escherichia coli Rosetta 2 (DE3) LEVO MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDK VYTLAKLYNLPADVLPR H4UPP6 MSP1D1 Homo sapiens 0.013975214 2 Escherichia coli Rosetta 2 (DE3) LEVO (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) (UNK)(UNK)(UNK)(UNK) DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE 0.0006919589999999999 2 PEF singleParticle particle 0.95 7.4 Quantifoil R1.2/1.3 400 CARBON HOLEY GLOW DISCHARGE ETHANE FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 2.7 29000.0 FEI TITAN KRIOS AUTOGRID HOLDER GATAN K2 SUMMIT (4k x 4k) SUPER-RESOLUTION 1-30 1 3212 6.0 71.0 1 1283606
ab-initio generated with CryoSparc v0.6
 1 C1 BACK PROJECTION 3.05 FSC 0.143 CUT-OFF cryoSPARC 2.12 731205 MAXIMUM LIKELIHOOD cryoSPARC 0.6 RELION 3.0 RELION 3.1 MAXIMUM LIKELIHOOD cryoSPARC 2.12 emd_22116.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 300 300 300 0 0 0 300 300 300 249.6 249.6 249.6 90.0 90.0 90.0 X Y Z -0.90852875 1.9043484 0.0010263837 0.07089551 0.832 0.832 0.832 0.27 AUTHOR MlaFEDB cryo-em density map, scharpened at -50 A^2 and cropped to 300x300x300 pixels. 5UW2 A PDB experimental model 6CM1 B PDB experimental model OTHER REAL emd_22116_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 500 500 500 0 0 0 500 500 500 416.0 416.0 416.0 90.0 90.0 90.0 X Y Z -0.5701114 1.3957922 -0.00018364137 0.027928073 0.832 0.832 0.832 AUTHOR MlaFEDB cryo-em density map (unsharpened and uncropped)