2024-03-06 REL RCSB RCSB RCSB 2020-02-25 2020-04-01 2020-11-11 2024-03-06 National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R01GM124451 United States National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS) R01GM088352 United States American Heart Association 18POST33960309 United States SthK P300A cyclic nucleotide-gated potassium channel in a putative active state, in complex with cAMP Schmidpeter PAM Rheinberger J Nimigean CM TRANSPORT PROTEIN Schmidpeter PAM Rheinberger J Nimigean CM Prolyl isomerization controls activation kinetics of a cyclic nucleotide-gated ion channel. Nat Commun UK 11 6401 6401 2020 33328472 doi:10.1038/s41467-020-20104-4 2041-1723 EMD-7484 other EM volume
WT SthK
 EMD-21453 other EM volume
SthK P300A cyclic nucleotide-gated potassium channel in the closed state, in complex with cAMP
 6vy0 FULLOVERLAP SthK P300A bound to cAMP SthK P300A bound to cAMP 0 1
Low-populated state of SthK P300A reconstituted into nanodiscs. Due to the low resolution, side chains could not be assigned and all amino acids are modeled as alanine. The register is maintained from the high-resolution structure of the closed state.
Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203) SthK Spirochaeta thermophila DSM 6578 ATCC 700085 / DSM 6578 / Z-1203 0.05109253899999999 4 Escherichia coli BL21(DE3) LEVO MAKDIGINSDPNSSSVDKLMKSSGVSNPTYTLVWKVWILAVTLYYAIRIPLTLVFPSLFSPLLPLDILASLALIADIPLD LAFESRRTSGRKPTLLAPSRLPDLLAALPLDLLVFALHLPSPLSLLSLVRLLKLISVQRSATRILSYRINPALLRLLSLV GFILLAAHGIACGWMSLQPPSENPAGTRYLSAFYWTITTLTTIGYGDITPSTPTQTVYTIVIELLGAAMYGLVIGNIASL VSKLDAAKLLHRERVERVTAFLSYKRISPELQRRIIEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVAL FKGAGEEFIRDIILHLEPVIYGPGEYIIRAGEMGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATV RARAFCDLYRLDKETFDRILSRYPEIAAQIQELAVRRKELESSGLVPRGSVKHHHH G0GA88 singleParticle particle 7.5 7.4 10.0 HEPES 100.0 KCl potassium chloride 3.0 cAMP 3.0 Fos-Choline-8, Fluorinated Quantifoil, UltrAuFoil, R1.2/1.3 GOLD 300 HOLEY ARRAY GLOW DISCHARGE AIR ETHANE 100 295.15 FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 0.001 1.0 2.2 105000.0 45620.0 FEI TITAN KRIOS AUTOGRID HOLDER NITROGEN Microscope was modified with a Cs corrector GIF Bioquantum 20 GATAN K2 QUANTUM (4k x 4k) COUNTING 3838 3710 1-50 1 2494 10.0 71.0 1 657943 EMD-7484 C4 6.68 FSC 0.143 CUT-OFF RELION 3.0-beta 19918 ANGULAR RECONSTITUTION RELION 3.0-beta ANGULAR RECONSTITUTION RELION 3.0-beta emd_21454.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 280.6016 280.6016 280.6016 90.0 90.0 90.0 X Y Z -0.003229137 0.034275237 0.0003746998 0.0022572991 1.0961 1.0961 1.0961 0.0166 AUTHOR map after refinement REAL emd_21454_msk_1.map emd_21454_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 280.576 280.576 280.576 90.0 90.0 90.0 X Y Z -0.019374955 0.061078116 0.00036963655 0.00273525 1.096 1.096 1.096 AUTHOR map after postprocessing emd_21454_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 280.6016 280.6016 280.6016 90.0 90.0 90.0 X Y Z -0.01464411 0.03924631 0.00036921314 0.002648673 1.0961 1.0961 1.0961 AUTHOR unfiltered half map 2 from the refinement emd_21454_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 280.6016 280.6016 280.6016 90.0 90.0 90.0 X Y Z -0.013833481 0.040338874 0.00037005995 0.0026802837 1.0961 1.0961 1.0961 AUTHOR unfiltered half map 1 from the refinement