<?xml version="1.0" encoding="UTF-8"?>
<emd xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:noNamespaceSchemaLocation="https://ftp.ebi.ac.uk/pub/databases/em_ebi/emdb_related/emdb-schemas/emdb_schemas/v3/v3_0_9_3/emdb.xsd" version="3.0.9.3" emdb_id="EMD-19758">
    <admin>
        <current_status>
            <date>2024-09-18</date>
            <code>REL</code>
            <processing_site>PDBe</processing_site>
        </current_status>
        <sites>
            <deposition>PDBe</deposition>
            <last_processing>PDBe</last_processing>
        </sites>
        <key_dates>
            <deposition>2024-02-27</deposition>
            <header_release>2024-07-24</header_release>
            <map_release>2024-07-24</map_release>
            <update>2024-09-18</update>
        </key_dates>
        <grant_support>
            <grant_reference>
                <funding_body>Wellcome Trust</funding_body>
                <code>217089</code>
                <country>United Kingdom</country>
            </grant_reference>
        </grant_support>
        <title>Cryo-EM Structure of the R388 plasmid conjugative pilus reveals a helical polymer characterised by an unusual pilin/phospholipid binary complex</title>
        <authors_list>
            <author>Vadakkepat AK</author>
            <author>Waksman G</author>
            <author>Redzej A</author>
        </authors_list>
        <keywords>Conjugal transfer protein, VirB2, Conjugative pilus, Type-4 secretion system fibre, Conduit for horizontal gene transfer, anti-microbial resistance, PROTEIN FIBRIL</keywords>
    </admin>
    <crossreferences>
        <citation_list>
            <primary_citation>
                <journal_citation published="true">
                    <author order="1">Vadakkepat AK</author>
                    <author order="2">Xue S</author>
                    <author order="3">Redzej A</author>
                    <author order="4">Smith TK</author>
                    <author order="5">Ho BT</author>
                    <author order="6">Waksman G</author>
                    <title>Cryo-EM structure of the R388 plasmid conjugative pilus reveals a helical polymer characterized by an unusual pilin/phospholipid binary complex.</title>
                    <journal_abbreviation>Structure</journal_abbreviation>
                    <country>UK</country>
                    <volume>32</volume>
                    <first_page>1335</first_page>
                    <year>2024</year>
                    <external_references type="PUBMED">39002540</external_references>
                    <external_references type="DOI">doi:10.1016/j.str.2024.06.009</external_references>
                    <external_references type="ISSN">0969-2126</external_references>
                    <external_references type="CSD">2005</external_references>
                    <external_references type="ASTM">STRUE6</external_references>
                </journal_citation>
            </primary_citation>
        </citation_list>
        <pdb_list>
            <pdb_reference>
                <pdb_id>8s6h</pdb_id>
                <relationship>
                    <in_frame>FULLOVERLAP</in_frame>
                </relationship>
            </pdb_reference>
        </pdb_list>
    </crossreferences>
    <sample>
        <name>Conjugative pilus from the E. coli R388 plasmid</name>
        <supramolecule_list>
            <complex_supramolecule supramolecule_id="1">
                <name>Conjugative pilus from the E. coli R388 plasmid</name>
                <parent>0</parent>
                <macromolecule_list>
                    <macromolecule>
                        <macromolecule_id>1</macromolecule_id>
                    </macromolecule>
                </macromolecule_list>
                <details>Helical filament called the conjugative pilus. This is part of the type-4 secretion system. Monomeric unit of the complex comprises of the protein VirB2/TrwL (for R388 pilus) and a lipid PG 32.1</details>
                <natural_source database="NCBI">
                    <organism ncbi="562">Escherichia coli</organism>
                    <strain>HB101</strain>
                    <cellular_location>Cell Surface</cellular_location>
                </natural_source>
                <molecular_weight>
                    <theoretical units="kDa/nm">7.39</theoretical>
                </molecular_weight>
            </complex_supramolecule>
        </supramolecule_list>
        <macromolecule_list>
            <protein_or_peptide macromolecule_id="1">
                <name>TrwL protein</name>
                <natural_source database="NCBI">
                    <organism ncbi="634468">Escherichia coli HB101</organism>
                </natural_source>
                <molecular_weight>
                    <theoretical units="MDa">0.007396732</theoretical>
                </molecular_weight>
                <details>The first 43 amino acids have been cleaved off from the pro-pilin TrwL/VirB2 during post-translational processing for maturation.</details>
                <number_of_copies>69</number_of_copies>
                <enantiomer>LEVO</enantiomer>
                <sequence>
                    <string>AQGLEKARSVLETLQQELTTIVPIAAAVILLCLGIAYAGRFIEKDTFVRWSIGVIIAGSAVQITAMLFT</string>
                    <external_references type="UNIPROTKB">O50328</external_references>
                </sequence>
            </protein_or_peptide>
            <ligand macromolecule_id="2">
                <name>1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE</name>
                <molecular_weight>
                    <theoretical units="MDa">0.00072297</theoretical>
                </molecular_weight>
                <number_of_copies>69</number_of_copies>
                <formula>LHG</formula>
            </ligand>
        </macromolecule_list>
    </sample>
    <structure_determination_list>
        <structure_determination structure_determination_id="1">
            <method>helical</method>
            <aggregation_state>helicalArray</aggregation_state>
            <specimen_preparation_list>
                <helical_preparation preparation_id="1">
                    <concentration units="mg/mL">0.25</concentration>
                    <buffer>
                        <ph>7.4</ph>
                        <component>
                            <concentration units="mM">10.0</concentration>
                            <formula>Na2HPO4</formula>
                            <name>Sodium Phosphate</name>
                        </component>
                        <component>
                            <concentration units="mM">1.8</concentration>
                            <formula>KH2PO4</formula>
                            <name>Potassium Phosphate</name>
                        </component>
                        <component>
                            <concentration units="mM">2.7</concentration>
                            <formula>KCl</formula>
                            <name>Potassium Chloride</name>
                        </component>
                        <component>
                            <concentration units="mM">2.7</concentration>
                            <formula>NaCl</formula>
                            <name>Sodium Chloride</name>
                        </component>
                        <details>Phosphate buffer saline</details>
                    </buffer>
                    <grid>
                        <model>C-flat-1.2/1.3</model>
                        <material>COPPER/PALLADIUM</material>
                        <mesh>400</mesh>
                        <support_film film_type_id="1">
                            <film_material>GRAPHENE OXIDE</film_material>
                            <film_topology>CONTINUOUS</film_topology>
                            <film_thickness>100.0</film_thickness>
                        </support_film>
                        <pretreatment>
                            <type>GLOW DISCHARGE</type>
                            <time units="s">30</time>
                        </pretreatment>
                    </grid>
                    <vitrification>
                        <cryogen_name>ETHANE</cryogen_name>
                        <chamber_humidity units="percentage">100</chamber_humidity>
                        <chamber_temperature units="K">277.15</chamber_temperature>
                        <instrument>FEI VITROBOT MARK IV</instrument>
                        <details>C-flat grids (Protochips, US 1.2/1.3 400 mesh) were negatively glow discharged using PELCO Easiglow (Ted Pella, USA) and coated with graphene oxide. 3 microliter of the purified pili sample was applied on each grid and a Vitrobot Mark IV (Thermo Fisher Scientific, USA) operating at 4C and 100 percent humidity was used to incubate the sample on the grid for 30 secs and blotting for 16 secs (blot force -10) prior to vitrification in liquid ethane.. </details>
                    </vitrification>
                    <details>This specimen was purified to high levels.</details>
                </helical_preparation>
            </specimen_preparation_list>
            <microscopy_list>
                <helical_microscopy microscopy_id="1">
                    <microscope>FEI TITAN KRIOS</microscope>
                    <illumination_mode>FLOOD BEAM</illumination_mode>
                    <imaging_mode>BRIGHT FIELD</imaging_mode>
                    <electron_source>FIELD EMISSION GUN</electron_source>
                    <acceleration_voltage units="kV">300</acceleration_voltage>
                    <nominal_cs units="mm">2.7</nominal_cs>
                    <nominal_defocus_min units="µm">0.9</nominal_defocus_min>
                    <calibrated_defocus_min units="µm">0.9</calibrated_defocus_min>
                    <nominal_defocus_max units="µm">2.4</nominal_defocus_max>
                    <calibrated_defocus_max units="µm">2.4</calibrated_defocus_max>
                    <nominal_magnification>81000.0</nominal_magnification>
                    <calibrated_magnification>81000.0</calibrated_magnification>
                    <specimen_holder_model>FEI TITAN KRIOS AUTOGRID HOLDER</specimen_holder_model>
                    <cooling_holder_cryogen>NITROGEN</cooling_holder_cryogen>
                    <temperature>
                        <temperature_min units="K">80.0</temperature_min>
                        <temperature_max units="K">80.0</temperature_max>
                    </temperature>
                    <alignment_procedure>
                        <coma_free/>
                    </alignment_procedure>
                    <details>The R388 pilus data were collected at the ISMB Birkbeck EM facility using a Titan Krios microscope (Thermo Fisher Scientific, USA) operated at 300 keV and equipped with a BioQuantum energy filter (Gatan, USA) with a slit width of 20 eV. The images were collected with a post-GIF K3 direct electron detector (Gatan, USA) operating in super resolution mode, at a magnification of 81,000 corresponding to a pixel size of 1.067 A. The dose rate was set to 14.62 e per pixel per second and a total dose of 34.67 e per A2 was fractionated over 50 frames.</details>
                    <image_recording_list>
                        <image_recording image_recording_id="1">
                            <film_or_detector_model>GATAN K3 BIOQUANTUM (6k x 4k)</film_or_detector_model>
                            <number_real_images>4884</number_real_images>
                            <average_electron_dose_per_image units="e/Å^2">34.67</average_electron_dose_per_image>
                            <details>The R388 pilus data were collected at the ISMB Birkbeck EM facility using a Titan Krios microscope (Thermo Fisher Scientific, USA) operated at 300 keV and equipped with a BioQuantum energy filter (Gatan, USA) with a slit width of 20 eV. The images were collected with a post-GIF K3 direct electron detector (Gatan, USA) operating in super resolution mode, at a magnification of 81,000 corresponding to a pixel size of 1.067 A. The dose rate was set to 14.62 e per pixel per second and a total dose of 34.67 e per A2 was fractionated over 50 frames. Data were collected using the EPU software with a defocus range 0.9 micrometer to 2.4 micrometer and a total of 4884 movies were collected.</details>
                        </image_recording>
                    </image_recording_list>
                </helical_microscopy>
            </microscopy_list>
            <helical_processing image_processing_id="1">
                <image_recording_id>1</image_recording_id>
                <details>Find more details in the Methods section of the publication</details>
                <final_reconstruction>
                    <number_classes_used>3</number_classes_used>
                    <applied_symmetry>
                        <helical_parameters>
                            <delta_z units="Å">13.241</delta_z>
                            <delta_phi units="deg">28.983</delta_phi>
                            <axial_symmetry>C1</axial_symmetry>
                        </helical_parameters>
                    </applied_symmetry>
                    <resolution units="Å" res_type="BY AUTHOR">3.39</resolution>
                    <resolution_method>FSC 0.143 CUT-OFF</resolution_method>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>CRYOSPARC v4.3.1</version>
                        </software>
                    </software_list>
                    <details>Find more details in the Methods section of the publication</details>
                    <number_images_used>209930</number_images_used>
                </final_reconstruction>
                <segment_selection>
                    <number_selected>1158759</number_selected>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>CRYOSPARC v4.3.1</version>
                        </software>
                    </software_list>
                    <details>Find more details in the Methods section of the publication</details>
                </segment_selection>
                <startup_model type_of_model="NONE">
                    <details>Find more details in the Methods section of the publication</details>
                </startup_model>
                <final_angle_assignment>
                    <type>NOT APPLICABLE</type>
                    <software_list>
                        <software>
                            <name>cryoSPARC</name>
                            <version>CRYOSPARC v4.3.1</version>
                        </software>
                    </software_list>
                    <details>Find more details in the Methods section of the publication</details>
                </final_angle_assignment>
            </helical_processing>
        </structure_determination>
    </structure_determination_list>
    <map format="CCP4" size_kbytes="256001">
        <file>emd_19758.map.gz</file>
        <symmetry>
            <space_group>1</space_group>
        </symmetry>
        <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
        <dimensions>
            <col>400</col>
            <row>400</row>
            <sec>400</sec>
        </dimensions>
        <origin>
            <col>0</col>
            <row>0</row>
            <sec>0</sec>
        </origin>
        <spacing>
            <x>400</x>
            <y>400</y>
            <z>400</z>
        </spacing>
        <cell>
            <a units="Å">426.80002</a>
            <b units="Å">426.80002</b>
            <c units="Å">426.80002</c>
            <alpha units="deg">90.0</alpha>
            <beta units="deg">90.0</beta>
            <gamma units="deg">90.0</gamma>
        </cell>
        <axis_order>
            <fast>X</fast>
            <medium>Y</medium>
            <slow>Z</slow>
        </axis_order>
        <statistics>
            <minimum>-1.0331122</minimum>
            <maximum>2.2909944</maximum>
            <average>0.0002951389</average>
            <std>0.08620985</std>
        </statistics>
        <pixel_spacing>
            <x units="Å">1.067</x>
            <y units="Å">1.067</y>
            <z units="Å">1.067</z>
        </pixel_spacing>
        <contour_list>
            <contour primary="true">
                <level>0.321</level>
                <source>AUTHOR</source>
            </contour>
        </contour_list>
        <label>::::EMDATABANK.org::::EMD-19758::::</label>
        <annotation_details>Sharpened map of the R388 Pilus filament generated using cryosparc</annotation_details>
    </map>
    <interpretation>
        <modelling_list>
            <modelling>
                <initial_model>
                    <chain>
                        <source_name>AlphaFold</source_name>
                        <initial_model_type>in silico model</initial_model_type>
                    </chain>
                </initial_model>
                <refinement_protocol>RIGID BODY FIT</refinement_protocol>
                <details>Find more details in the Methods section of the publication</details>
                <target_criteria>Cross-correlation in Phenix</target_criteria>
                <overall_bvalue>109.700000000000003</overall_bvalue>
            </modelling>
        </modelling_list>
        <half_map_list>
            <half_map format="CCP4" size_kbytes="256001">
                <file>emd_19758_half_map_2.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>400</col>
                    <row>400</row>
                    <sec>400</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>400</x>
                    <y>400</y>
                    <z>400</z>
                </spacing>
                <cell>
                    <a units="Å">426.80002</a>
                    <b units="Å">426.80002</b>
                    <c units="Å">426.80002</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.52427363</minimum>
                    <maximum>1.107906</maximum>
                    <average>0.0006985617</average>
                    <std>0.07670593</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.067</x>
                    <y units="Å">1.067</y>
                    <z units="Å">1.067</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-19758::::</label>
                <annotation_details>Halfmap-A of the R388 Pilus filament generated using cryosparc and used to calculate the FSC curve using LocalResolution in Cryosparc. The resulting FSC curve shown in the associated publication.</annotation_details>
            </half_map>
            <half_map format="CCP4" size_kbytes="256001">
                <file>emd_19758_half_map_1.map.gz</file>
                <symmetry>
                    <space_group>1</space_group>
                </symmetry>
                <data_type>IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES)</data_type>
                <dimensions>
                    <col>400</col>
                    <row>400</row>
                    <sec>400</sec>
                </dimensions>
                <origin>
                    <col>0</col>
                    <row>0</row>
                    <sec>0</sec>
                </origin>
                <spacing>
                    <x>400</x>
                    <y>400</y>
                    <z>400</z>
                </spacing>
                <cell>
                    <a units="Å">426.80002</a>
                    <b units="Å">426.80002</b>
                    <c units="Å">426.80002</c>
                    <alpha units="deg">90.0</alpha>
                    <beta units="deg">90.0</beta>
                    <gamma units="deg">90.0</gamma>
                </cell>
                <axis_order>
                    <fast>X</fast>
                    <medium>Y</medium>
                    <slow>Z</slow>
                </axis_order>
                <statistics>
                    <minimum>-0.5679981</minimum>
                    <maximum>1.1584297</maximum>
                    <average>0.0007798614</average>
                    <std>0.07678754</std>
                </statistics>
                <pixel_spacing>
                    <x units="Å">1.067</x>
                    <y units="Å">1.067</y>
                    <z units="Å">1.067</z>
                </pixel_spacing>
                <contour_list>
                    <contour primary="true">
                        <source>AUTHOR</source>
                    </contour>
                </contour_list>
                <label>::::EMDATABANK.org::::EMD-19758::::</label>
                <annotation_details>Halfmap-B of the R388 Pilus filament generated using cryosparc and used to calculate the FSC curve using LocalResolution in Cryosparc. The resulting FSC curve shown in the associated publication.</annotation_details>
            </half_map>
        </half_map_list>
    </interpretation>
</emd>
