2025-04-30 REL PDBe INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY INITIAL_RELEASE REPOSITORY DATABASE_REFERENCES citation citation_author em_admin _citation.journal_abbrev _citation.journal_id_CSD _citation.journal_id_ISSN _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year _em_admin.last_update DATABASE_REFERENCES citation em_admin _citation.journal_volume _citation.page_first _citation.title _em_admin.last_update PDBe PDBe 2024-02-20 2025-03-05 2025-03-05 2025-04-30 Max Planck Society Germany The structure of the copia retrotransposon icosahedral capsid (T=9) Klumpe S Beck F Briggs JAG Beck M Plitzko JM Tomography, Drosophila, melanogaster, follicle cell, copia, Ty1, retrotransposon, LTR, VIRUS LIKE PARTICLE Klumpe S Senti KA Beck F Sachweh J Hampoelz B Ronchi P Oorschot V Brandstetter M Yeroslaviz A Briggs JAG Brennecke J Beck M Plitzko JM In-cell structure and snapshots of copia retrotransposons in intact tissue by cryo-ET. Cell 188 2094 2025 40049165 doi:10.1016/j.cell.2025.02.003 1097-4172 EMD-19643 other EM volume
Room temperature tomogram follicle cell
 EMD-19644 other EM volume
Room temperature tomogram follicle cell
 EMD-19645 other EM volume
Room temperature tomogram follicle cell
 EMD-19646 other EM volume
Room temperature tomogram follicle cell
 EMD-19647 other EM volume
Example cryo-tomogram of isolated follicle cell
 EMD-19648 other EM volume
Example cryo-tomogram of follicle cell from intact tissue via lift-out preparations
 EMD-19649 other EM volume
Intercapsid contact C1-C1
 EMD-19650 other EM volume
Intercapsid contact C1-C5
 EMD-19651 other EM volume
Intercapsid contact C5-C5
 8s41 FULLOVERLAP Copia retrotransposon capsid Copia retrotransposon capsid 0 1 Drosophila melanogaster Copia VLP protein Drosophila melanogaster 0.021400764 9 LEVO MDKAKRNIKPFDGEKYAIWKFRIRALLAEQDVLKVVDGLMPNEVDDSWKKAERCAKSTIIEYLSDSFLNFATSDITARQI LENLDAVYERKSLASQLALRKRLLSLKLSSEMSLLSHFHIFDELISELLAAGAKIEEMDKISHLLITLPSCYDGIITAIE TLSEENLTLAFVKNRLLDQEIKIKNDH P04146 subtomogramAveraging cell 7.0 ETHANE-PROPANE FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 3.5 5.0 FEI FALCON IV (4k x 4k) 3.0 1 I 7.7 FSC 0.143 CUT-OFF RELION 735 3 1780 STOPGAP 0.7 4 RELION 3.1 MAXIMUM LIKELIHOOD RELION 3.1 emd_19708.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 650.24 650.24 650.24 90.0 90.0 90.0 X Y Z -0.673441 2.2258365 0.068148896 0.26953828 2.54 2.54 2.54 1.0 AUTHOR Main postprocessed map emd_19708_msk_1.map emd_19708_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 650.24 650.24 650.24 90.0 90.0 90.0 X Y Z -0.3631529 2.2258365 0.05986276 0.21000804 2.54 2.54 2.54 AUTHOR Postprocessed masked map emd_19708_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 650.24 650.24 650.24 90.0 90.0 90.0 X Y Z -0.5982032 1.5335488 0.051008955 0.25002405 2.54 2.54 2.54 AUTHOR Half map 2 emd_19708_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 256 256 256 0 0 0 256 256 256 650.24 650.24 650.24 90.0 90.0 90.0 X Y Z -0.60951984 1.4890066 0.05093705 0.24996509 2.54 2.54 2.54 AUTHOR Half map 1