2025-03-26 REL PDBe INITIAL_RELEASE REPOSITORY STRUCTURE_SUMMARY citation citation_author em_admin pdbx_entry_details _citation.country _citation.journal_abbrev _citation.journal_id_CSD _citation.journal_id_ISSN _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year _citation_author.identifier_ORCID _em_admin.last_update DATABASE_REFERENCES citation em_admin _citation.journal_volume _citation.page_first _citation.page_last _citation.year _em_admin.last_update PDBe PDBe 2023-08-25 2024-09-18 2024-09-18 2025-03-26 Wellcome Trust 215553/Z/19/Z United Kingdom Cryo-EM structure of Vipp1-deltaH6_aa1-219 helical filament with lattice 2 (Vipp1-deltaH6_L2) Naskar S Low HH Vipp1/IM30/ESCRT-III, Membrane remodeling, Cryoelectron microscopy, Helical filament structure, LIPID BINDING PROTEIN Naskar S Merino A Espadas J Singh J Roux A Colom A Low HH Mechanism for Vipp1 spiral formation, ring biogenesis, and membrane repair. Nat.Struct.Mol.Biol. US 32 571 584 2025 39528797 doi:10.1038/s41594-024-01401-8 1545-9985 8qbv FULLOVERLAP Vipp1-deltaH6_L2 Vipp1-deltaH6_L2 0 1 Nostoc punctiforme ATCC 29133 / PCC 73102 Membrane-associated protein Vipp1 Nostoc punctiforme ATCC 29133 / PCC 73102 0.024292504 1 Escherichia coli LEVO MGLFDRIKRVVSSNLNDLVNKAEDPEKMLEQAILEMQEDLVQLRQGVAQAIAAQKRSEKQYNDAQNEINKWQRNAQLALQ KGDENLARQALERKKTYTDTSAALKASLDTQSTQVETLKRNLIQLESKISEAKTKKEMLKARITTAKAQEQLQGMVRGMN TSSAMSAFERMEEKVLMQESRAQALGELAGADLETQFAQLEGGSDVDDELAALKAQM B2J6D9 helical filament 1.5 8.4 Quantifoil R2/2 COPPER 300 PLASMA CLEANING ETHANE 100 283.15 FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 0.75 2.5 GATAN K3 (6k x 4k) 3.0 1.5 1 2.15543 68.507182 C1 3.78 FSC 0.143 CUT-OFF RELION 4 38361 NOT APPLICABLE emd_18321.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 450 450 450 0 0 0 450 450 450 495.0 495.0 495.0 90.0 90.0 90.0 Z Y X -19.276806000000001 27.704027 -0.000000000000225 1.0 1.1 1.1 1.1 3.3 AUTHOR Primary sharpened map. REAL 189.949999999999989 emd_18321_additional_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 450 450 450 0 0 0 450 450 450 495.0 495.0 495.0 90.0 90.0 90.0 X Y Z -0.0059917294 0.021520391 0.00007444353 0.0018596376 1.1 1.1 1.1 AUTHOR Unsharpened and unmasked raw map from 3D auto-refinement. emd_18321_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 450 450 450 0 0 0 450 450 450 495.0 495.0 495.0 90.0 90.0 90.0 X Y Z -0.007518352 0.024271512 0.00007523216 0.0019615144 1.1 1.1 1.1 AUTHOR Unmasked raw half-map 2. emd_18321_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 450 450 450 0 0 0 450 450 450 495.0 495.0 495.0 90.0 90.0 90.0 X Y Z -0.0076262164 0.023703026 0.00007355859 0.0019575318 1.1 1.1 1.1 AUTHOR Unmasked raw half-map 1.