2023-10-18 REL PDBe PDBe PDBe 2023-08-19 2023-10-11 2023-10-11 2023-10-18 Medical Research Council (MRC, United Kingdom) MC-UP-A025-1013 United Kingdom Medical Research Council (MRC, United Kingdom) MC-U105184291 United Kingdom P301S Tau Filaments from the Brains of Tg2541 Transgenic Mouse Line Schweighauser M Murzin AG Macdonald J Lavenir I Crowther RA Scheres SHW Goedert M P301S tau, Frontotemporal dementia and parkinsonism linked to chromosome 17, Transgenic mice, Electron cryo-microscopy, PROTEIN FIBRIL Schweighauser M Murzin AG Macdonald J Lavenir I Crowther RA Scheres SHW Goedert M Cryo-EM structures of tau filaments from the brains of mice transgenic for human mutant P301S Tau. Acta Neuropathol Commun UK 11 160 160 2023 37798679 doi:10.1186/s40478-023-01658-y 2051-5960 8q96 FULLOVERLAP P301S Tau Protein Filament (Tg2541) P301S Tau Protein Filament (Tg2541) 0 1 2 3
Human P301S tau filaments extracted from the brains of transgenic mouse line Tg2541
Mus musculus Tg2541 Brain Brainstem Isoform Tau-E of Microtubule-associated protein tau Mus musculus Tg2541 Brain Brainstem 0.005961934 4 LEVO KVQIINKKLDLSNVQSKCGSKDNIKHVSGGGSVQIVYKPVDLSKVTSKCGSLGNIH P10637 Unknown protein Mus musculus Tg2541 Brain Brainstem 0.0010392729999999998 4 LEVO (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) Unknown protein Mus musculus Tg2541 Brain Brainstem 0.000869063 4 LEVO (UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK) helical filament 7.4 ETHANE 100 277 FEI VITROBOT MARK IV FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 1.8 2.4 105000.0 NITROGEN GATAN K2 SUMMIT (4k x 4k) COUNTING 34.2 1 4.75 -0.83 C1 3.09 FSC 0.143 CUT-OFF RELION 4.1 22760 NOT APPLICABLE emd_18269.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 220 220 220 0 0 0 220 220 220 253.0 253.0 253.0 90.0 90.0 90.0 X Y Z -0.046236455 0.12216287 0.0004340104 0.005403687 1.15 1.15 1.15 0.025 AUTHOR emd_18269_msk_1.map emd_18269_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 220 220 220 0 0 0 220 220 220 253.0 253.0 253.0 90.0 90.0 90.0 X Y Z -0.0378093 0.08695669 0.00018323163 0.0046197986 1.15 1.15 1.15 AUTHOR emd_18269_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 220 220 220 0 0 0 220 220 220 253.0 253.0 253.0 90.0 90.0 90.0 X Y Z -0.037728082 0.08233486 0.00019734055 0.0046268585 1.15 1.15 1.15 AUTHOR