2023-11-08 REL PDBe PDBe PDBe 2023-01-06 2023-09-20 2023-09-20 2023-11-08 iNEXT-Discovery 871037 European Union Agence Nationale de la Recherche (ANR) ANR-10-INSB-05 France HSF2BP-BRCA2 ring-shaped complex Zinn-Justin S Ghouil R Miron S Legrand P Ouldali M Winter JM Ropars V Arteni AA Meiosis, Cancer Antigen, DNA repair, Fertility, Armadillo domain, Intrinsically Disordered Protein, RECOMBINATION Ghouil R Miron S Sato K Ristic D van Rossum-Fikkert SE Legrand P Ouldali M Winter JM Ropars V David G Arteni AA Wyman C Knipscheer P Kanaar R Zelensky AN Zinn-Justin S BRCA2-HSF2BP oligomeric ring disassembly by BRME1 promotes homologous recombination. Sci Adv US 9 eadi7352 eadi7352 2023 37889963 doi:10.1126/sciadv.adi7352 2375-2548 Complex between HSF2BP and the BRCA2 fragment N2291-Q2342 Complex between HSF2BP and the BRCA2 fragment N2291-Q2342 0 1 2
The complex contains 24 HSF2BP molecules and 12 BRCA2 peptides
Homo sapiens 900 HSF2BP Homo sapiens
Full-length human HSF2BP
Escherichia coli LEVO MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIV EKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYC TEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDES QFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNV SINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSL PLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV BRCA2 Homo sapiens
BRCA2 from N2291 to Q2342 with a C-terminal TEV site (was produced fused to GB1-6His)
Escherichia coli LEVO NEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITTVPFRTTKERQENLYFQ singleParticle particle 3 7.5 150.0 NaCl sodium chloride 25.0 Tris-HCl Tris buffer 5.0 beta-mercaptoethanol reducing agent Quantifoil R2/2 GOLD 300 ETHANE 100 277 FEI VITROBOT MARK IV
Obtained after gel filtration on the complex
 FEI TITAN KRIOS OTHER BRIGHT FIELD FIELD EMISSION GUN 300 100.0 2.7 0.4 1.8 TFS Selectris X 10 TFS FALCON 4i (4k x 4k) 9531 40.0 1 660000 2 D3 3.26 FSC 0.143 CUT-OFF cryoSPARC 4.1 398000 NOT APPLICABLE cryoSPARC NOT APPLICABLE cryoSPARC 3 cryoSPARC
One of these volumes had the shape of an open ring, the two other volumes were well-resolved rings. The 398 000 particles corresponding to these two volumes were used to calculate the final cryo-EM map of the complex.
 emd_16432.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 600 600 600 0 0 0 600 600 600 438.0 438.0 438.0 90.0 90.0 90.0 X Y Z -0.09052658 0.23730436 -0.000045229586 0.006442293 0.73 0.73 0.73 0.0272 AUTHOR emd_16432_half_map_1.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 600 600 600 0 0 0 600 600 600 438.0 438.0 438.0 90.0 90.0 90.0 X Y Z -0.13594523 0.28301114 0.000088968336 0.01414638 0.73 0.73 0.73 AUTHOR emd_16432_half_map_2.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 600 600 600 0 0 0 600 600 600 438.0 438.0 438.0 90.0 90.0 90.0 X Y Z -0.13260274 0.2907985 0.00009009637 0.0140681 0.73 0.73 0.73 AUTHOR