2024-11-06 REL PDBe PDBe PDBe 2021-09-06 2022-09-14 2022-09-14 2024-11-06 European Research Council (ERC) 109784 European Union Sulfolobus acidocaldarius 0406 filament. Isupov MN Gaines M cell surface appendage, beta-strand addition, isopeptide bond, N-glycosylation, beta-sandwich, PROTEIN FIBRIL Gaines MC Isupov MN Sivabalasarma S Haque RU McLaren M Mollat CL Tripp P Neuhaus A Gold VAM Albers SV Daum B Electron cryo-microscopy reveals the structure of the archaeal thread filament. Nat Commun UK 13 7411 7411 2022 36456543 doi:10.1038/s41467-022-34652-4 2041-1723 7pnb FULLOVERLAP Filament Filament 0 1 Sulfolobus acidocaldarius Sulfolobus acidocaldarius 0406 filament. Sulfolobus acidocaldarius 0.022291539 9 Sulfolobus acidocaldarius LEVO MNKKRLLLLSVFLVSVFVPVLVADVIYYYQGQITVGNVAPPMYFAIQPNGNAKIGNNSNVPSYINAQPSSGGSGFTAQVN ITNATYNYYFNFMGLAVSKTGYIYLAKVAYSYTATNNPIQNATLYIMNQQGQIVYKYKLIVNGVVNSTLPSTPLQINSGS YIVSLLIVPYQGTLPKTPSNDLATITVNFGFSPMTASPPPIPLPSP A0A0U2Y8S3 helical filament 3.0 ETHANE
Mixed population of filaments isolated from Sulfolobus acidocaldarius
 FEI TITAN KRIOS FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 300 GATAN K2 SUMMIT (4k x 4k) COUNTING 1 6272 42.33 1 1 31.649 -103.234 C1 3.46 FSC 0.143 CUT-OFF cryoSPARC 3.2.0 188620 410270 cryoSPARC 3.2.0 cryoSPARC filament tracer was used to automatically pick particles NOT APPLICABLE cryoSPARC 3.2.0 emd_13546.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 384 384 384 0 0 0 384 384 384 402.04803 402.04803 402.04803 90.0 90.0 90.0 X Y Z -0.015122809 1.5670989 0.00060520147 0.015186864 1.047 1.047 1.047 0.1638 AUTHOR AB INITIO MODEL
Jligand was used for preparing dictionaries for an unusual sugars and an isopeptide link beween main chain nitrogen of the N-terminal D25 and C gamma of N57 from N-2 monomer in the filament.
RECIPROCAL