2024-10-23 REL PDBe PDBe PDBe 2021-02-12 2021-10-13 2021-10-13 2024-10-23 Netherlands Organisation for Scientific Research (NWO) 740.018.007 Netherlands ordered protein arrays on the axoneme-facing surface of the outer mitochondrial membrane in pig sperm mitochondria (alignment focused on one unit) Leung MR Zeev-Ben-Mordehai T mitochondria, sperm, MEMBRANE PROTEIN Leung MR Zenezini Chiozzi R Roelofs MC Hevler JF Ravi RT Maitan P Zhang M Henning H Bromfield EG Howes SC Gadella BM Heck AJR Zeev-Ben-Mordehai T In-cell structures of conserved supramolecular protein arrays at the mitochondria-cytoskeleton interface in mammalian sperm. Proc.Natl.Acad.Sci.USA US 118 2021 34737233 doi:10.1073/pnas.2110996118 1091-6490 0040 PNASA6 7nie FULLOVERLAP subtomogram average of ordered protein arrays on the axoneme-facing surface of the outer mitochondrial membrane in pig sperm mitochondria (alignment focused on one unit) subtomogram average of ordered protein arrays on the axoneme-facing surface of the outer mitochondrial membrane in pig sperm mitochondria (alignment focused on one unit) 0 1 2 Sus scrofa sperm Glycerol kinase Sus scrofa sperm 0.053579547 4 LEVO MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIEQKFPKEGWVEQDPKEILQSVYECIEKTCEKLGQLNI DISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQSTVANLSKIIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDN VRKIQKAVEEDRALFGTIDSWLIWSLTGGARGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEVPMKILPNVRSSSEIY GLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCSVAIAGAVVRWLRDNLGIIKTSEEIEK LAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGG MTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLSAVTMERFEPQINAKESEIRYSTWKKAV KKSMGWV A0A287BD08 2.7.1.30 Voltage-dependent anion-selective channel protein 2 Sus scrofa sperm 0.031637484 12 LEVO MASYGQTCPRPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGL TFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECVNLGCDVDFDFAGPAIHGSAVFGYEGW LAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELEA F1S2F6 subtomogramAveraging cell 7.4 Quantifoil COPPER 200 CARBON HOLEY GLOW DISCHARGE ETHANE-PROPANE HOMEMADE PLUNGER FEI TALOS ARCTICA FLOOD BEAM BRIGHT FIELD FIELD EMISSION GUN 200 NITROGEN 20 GATAN K2 SUMMIT (4k x 4k) COUNTING 1.3 1 1 C2 35.0 FSC 0.5 CUT-OFF PEET 1.13.0 536 3 268 random particle from the dataset PEET 1.13.0 OTHER PEET 1.13.0 emd_12357.map.gz 1 IMAGE STORED AS FLOATING POINT NUMBER (4 BYTES) 80 40 40 0 0 0 80 40 40 347.2 173.6 173.6 90.0 90.0 90.0 X Y Z -0.6250339 0.8475203 -0.11555703 0.15212461 4.34 4.34 4.34 0.01 AUTHOR subtomogram average of ordered protein arrays on the axoneme-facing surface of the outer mitochondrial membrane in pig sperm mitochondria (alignment focused on one unit) RIGID BODY FIT
Homology models of pig glycerol kinase and VDAC2 were made using Robetta. Rigid body fitting was done with Chimera/ChimeraX. Putative GK proteins only fit in one orientation, but for VDAC proteins the rotation around the pore axis remains ambiguous.